Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|325
Gene name
LocationContig_109:9488..11069
Strand+
Gene length (bp)1581
Transcript length (bp)1269
Coding sequence length (bp)1269
Protein length (aa) 423

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 1.1E-12 122 350
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.4E-09 120 340

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 20 395 4.0E-72
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 42 381 3.0E-53
sp|P38295|MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHT1 PE=1 SV=1 18 384 6.0E-46
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 25 364 1.0E-41
sp|Q54H38|ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum GN=abhd PE=1 SV=1 122 364 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03649|YM60_YEAST Putative esterase YMR210W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR210W PE=1 SV=1 20 395 4.0E-72
sp|Q02891|MCFS1_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EEB1 PE=1 SV=1 42 381 3.0E-53
sp|P38295|MCFS2_YEAST Medium-chain fatty acid ethyl ester synthase/esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EHT1 PE=1 SV=1 18 384 6.0E-46
sp|Q40863|EMB8_PICGL Embryogenesis-associated protein EMB8 OS=Picea glauca GN=EMB8 PE=2 SV=1 25 364 1.0E-41
sp|Q54H38|ABHD_DICDI Abhydrolase domain-containing protein OS=Dictyostelium discoideum GN=abhd PE=1 SV=1 122 364 2.0E-36
sp|Q9QZC8|ABHD1_MOUSE Abhydrolase domain-containing protein 1 OS=Mus musculus GN=Abhd1 PE=1 SV=2 48 398 5.0E-31
sp|Q5RK23|ABHD1_RAT Abhydrolase domain-containing protein 1 OS=Rattus norvegicus GN=Abhd1 PE=2 SV=1 48 366 2.0E-30
sp|Q96SE0|ABHD1_HUMAN Abhydrolase domain-containing protein 1 OS=Homo sapiens GN=ABHD1 PE=1 SV=2 48 366 2.0E-30
sp|Q91ZH7|ABHD3_MOUSE Phospholipase ABHD3 OS=Mus musculus GN=Abhd3 PE=1 SV=1 121 384 6.0E-30
sp|Q8WU67|ABHD3_HUMAN Phospholipase ABHD3 OS=Homo sapiens GN=ABHD3 PE=1 SV=2 90 366 7.0E-30
sp|Q0VC00|ABHD3_BOVIN Phospholipase ABHD3 OS=Bos taurus GN=ABHD3 PE=2 SV=1 90 366 5.0E-29
sp|Q3T0A0|ABHD1_BOVIN Abhydrolase domain-containing protein 1 OS=Bos taurus GN=ABHD1 PE=2 SV=1 48 366 3.0E-27
sp|P45524|YHET_ECOLI Putative esterase YheT OS=Escherichia coli (strain K12) GN=yheT PE=3 SV=1 114 375 1.0E-26
sp|Q18610|YYC5_CAEEL Putative esterase C44C1.5 OS=Caenorhabditis elegans GN=C44C1.5 PE=3 SV=1 90 368 3.0E-25
sp|Q5EA42|ABHD2_BOVIN Abhydrolase domain-containing protein 2 OS=Bos taurus GN=ABHD2 PE=2 SV=1 124 377 3.0E-21
sp|Q9QXM0|ABHD2_MOUSE Abhydrolase domain-containing protein 2 OS=Mus musculus GN=Abhd2 PE=1 SV=1 124 377 7.0E-21
sp|P08910|ABHD2_HUMAN Abhydrolase domain-containing protein 2 OS=Homo sapiens GN=ABHD2 PE=2 SV=1 124 377 1.0E-20
sp|Q4R2Y9|ABHD2_MACFA Abhydrolase domain-containing protein 2 OS=Macaca fascicularis GN=ABHD2 PE=2 SV=1 124 377 1.0E-20
sp|Q24093|ABHD2_DROME Abhydrolase domain-containing protein 2 OS=Drosophila melanogaster GN=Hydr2 PE=2 SV=2 107 377 3.0E-18
sp|Q05AK6|ABH2B_DANRE Abhydrolase domain-containing protein 2-B OS=Danio rerio GN=abhd2b PE=2 SV=1 107 377 4.0E-16
sp|Q802V6|ABH2A_DANRE Abhydrolase domain-containing protein 2-A OS=Danio rerio GN=abhd2a PE=2 SV=1 124 377 5.0E-16
sp|Q5F2F2|ABH15_MOUSE Abhydrolase domain-containing protein 15 OS=Mus musculus GN=Abhd15 PE=1 SV=1 51 361 3.0E-10
sp|Q6UXT9|ABH15_HUMAN Abhydrolase domain-containing protein 15 OS=Homo sapiens GN=ABHD15 PE=2 SV=2 48 365 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|325
MEWFGRAQLAFTHAPTPVTIKLRDGTDTDLVKICEKATPPCQLNPLLFNGHLQTLWSASKPHGPRVYYRRKTFEA
DDTSYRGSFAVDFAVEPFEGNDPGLPWRTRHFTPDELSNMGSNDAKPMLVILHGLSGGSHEVYLRHAIAPLLQEG
GWEACVVNSRGCAHSKITSGLLYNARSTWDLRQTVKWLRKTYPNRPLFGLGFSLGANMLTTYCGEEGSDCLLKAA
IACSNPFKLDISCRYLLDSLIGREVYLRTMASSLKVLVEEHKKELQLYSDLDMEAIDKITYLPEFDRTVQCPTWG
YPTEQAYYRDASSSDAVLAIRIPFMALHATDDPIAVRQAIPYEEFQQNPSTVLVTSSLGGHLCWFESGGTRWFPR
PICNFFNRMAFDVDLDALKPRKGPTSHTSTAKTTFEPMRRKLNPVDI*
Coding >Ophun1|325
ATGGAGTGGTTCGGCAGGGCTCAGCTCGCCTTTACTCACGCCCCAACGCCCGTGACCATCAAGCTTAGGGACGGG
ACGGATACCGACCTGGTCAAGATTTGCGAAAAGGCGACGCCACCGTGCCAGCTGAACCCACTTCTCTTCAACGGT
CACCTTCAGACACTATGGTCCGCCAGCAAACCTCATGGCCCCAGGGTCTATTATCGACGCAAGACTTTCGAGGCC
GATGATACGTCATATCGAGGCTCTTTCGCCGTCGACTTCGCCGTCGAGCCCTTCGAAGGCAACGATCCCGGTCTG
CCGTGGAGAACGCGCCACTTCACCCCAGACGAATTGAGCAACATGGGCTCCAACGATGCCAAGCCTATGCTCGTC
ATTCTCCACGGTCTGTCGGGTGGGTCACACGAAGTCTATCTTAGACACGCCATCGCTCCTCTGCTGCAAGAGGGC
GGTTGGGAGGCTTGCGTCGTCAACTCGCGTGGCTGTGCGCACAGCAAGATCACCAGCGGCCTGCTTTATAATGCT
CGGAGCACTTGGGACCTGCGACAGACGGTGAAATGGTTGCGCAAGACCTATCCCAACCGGCCTCTCTTTGGCCTC
GGATTCTCTCTTGGCGCCAACATGCTCACCACTTACTGCGGGGAAGAAGGCTCCGACTGTCTGCTCAAGGCCGCC
ATTGCCTGCTCGAATCCATTCAAGTTGGACATTTCCTGCAGGTATCTGCTGGATAGTCTCATCGGCAGGGAGGTC
TATCTCCGCACCATGGCCAGCTCGTTGAAAGTTCTGGTGGAGGAACACAAGAAGGAGTTGCAGCTATATAGCGAT
CTGGACATGGAAGCCATCGACAAGATCACATATCTCCCCGAATTTGATCGAACAGTTCAGTGCCCAACTTGGGGC
TATCCCACAGAGCAGGCCTATTACCGCGACGCCTCGTCGTCAGACGCCGTGCTGGCCATCAGGATTCCTTTCATG
GCACTTCACGCTACCGACGACCCGATTGCTGTGCGCCAGGCGATACCTTACGAGGAGTTTCAGCAGAATCCAAGC
ACGGTTCTCGTCACCTCTTCGCTAGGAGGCCATCTCTGCTGGTTCGAATCGGGCGGGACCAGGTGGTTCCCTCGT
CCGATATGCAACTTCTTCAACCGCATGGCCTTTGACGTCGACCTGGATGCCCTCAAGCCGCGGAAGGGCCCGACG
AGTCATACATCGACGGCGAAGACAACTTTTGAGCCCATGCGCCGGAAATTGAACCCCGTCGACATATAG
Transcript >Ophun1|325
ATGGAGTGGTTCGGCAGGGCTCAGCTCGCCTTTACTCACGCCCCAACGCCCGTGACCATCAAGCTTAGGGACGGG
ACGGATACCGACCTGGTCAAGATTTGCGAAAAGGCGACGCCACCGTGCCAGCTGAACCCACTTCTCTTCAACGGT
CACCTTCAGACACTATGGTCCGCCAGCAAACCTCATGGCCCCAGGGTCTATTATCGACGCAAGACTTTCGAGGCC
GATGATACGTCATATCGAGGCTCTTTCGCCGTCGACTTCGCCGTCGAGCCCTTCGAAGGCAACGATCCCGGTCTG
CCGTGGAGAACGCGCCACTTCACCCCAGACGAATTGAGCAACATGGGCTCCAACGATGCCAAGCCTATGCTCGTC
ATTCTCCACGGTCTGTCGGGTGGGTCACACGAAGTCTATCTTAGACACGCCATCGCTCCTCTGCTGCAAGAGGGC
GGTTGGGAGGCTTGCGTCGTCAACTCGCGTGGCTGTGCGCACAGCAAGATCACCAGCGGCCTGCTTTATAATGCT
CGGAGCACTTGGGACCTGCGACAGACGGTGAAATGGTTGCGCAAGACCTATCCCAACCGGCCTCTCTTTGGCCTC
GGATTCTCTCTTGGCGCCAACATGCTCACCACTTACTGCGGGGAAGAAGGCTCCGACTGTCTGCTCAAGGCCGCC
ATTGCCTGCTCGAATCCATTCAAGTTGGACATTTCCTGCAGGTATCTGCTGGATAGTCTCATCGGCAGGGAGGTC
TATCTCCGCACCATGGCCAGCTCGTTGAAAGTTCTGGTGGAGGAACACAAGAAGGAGTTGCAGCTATATAGCGAT
CTGGACATGGAAGCCATCGACAAGATCACATATCTCCCCGAATTTGATCGAACAGTTCAGTGCCCAACTTGGGGC
TATCCCACAGAGCAGGCCTATTACCGCGACGCCTCGTCGTCAGACGCCGTGCTGGCCATCAGGATTCCTTTCATG
GCACTTCACGCTACCGACGACCCGATTGCTGTGCGCCAGGCGATACCTTACGAGGAGTTTCAGCAGAATCCAAGC
ACGGTTCTCGTCACCTCTTCGCTAGGAGGCCATCTCTGCTGGTTCGAATCGGGCGGGACCAGGTGGTTCCCTCGT
CCGATATGCAACTTCTTCAACCGCATGGCCTTTGACGTCGACCTGGATGCCCTCAAGCCGCGGAAGGGCCCGACG
AGTCATACATCGACGGCGAAGACAACTTTTGAGCCCATGCGCCGGAAATTGAACCCCGTCGACATATAG
Gene >Ophun1|325
ATGGAGTGGTTCGGCAGGGCTCAGCTCGCCTTTACTCACGCCCCAACGCCCGTGACCATCAAGCTTAGGGACGGG
ACGGATACCGACCTGGTCAAGATTTGCGAAAAGGCGACGCCACCGTGCCAGCTGAACCCACTTCTCTTCAACGGT
CACCTTCAGACACTATGGTCCGCCAGCAAACCTCATGGCCCCAGGGTCTATTATCGACGCAAGACTTTCGAGGCC
GATGATACGTCATATCGAGGCTCTTTCGCCGTCGACTTCGCCGTCGAGCCCTTCGAAGGCAACGATCCCGGTCTG
CCGTGGAGAACGCGCCACTTCACCCCAGACGAATTGAGCAACATGGGCTCCAACGATGCCAAGCCTATGCTCGTC
ATTCTCCACGGTCTGTCGGGTGGGTCACACGAAGTCTATCTTAGACACGCCATCGCTCCTCTGCTGCAAGAGGGC
GGTTGGGAGGCTTGCGTCGTCAACTCGCGTGGCTGTGCGCACAGCAAGATCACCAGCGGCCTGCTTTATAATGCT
CGGAGCACTTGGGACCTGCGACAGGTTTGTTGACGCCTGAGTACTACGTCTCGGCCTCGCTGATGGGATCAGACG
GTGAAATGGTTGCGCAAGACCTATCCCAACCGGCCTCTCTTTGGCCTCGGATTCTCTCTTGGCGCCAACATGCTC
ACCACTGTAAGTAATTTATTGTCTGTCCTTCTGTGAGTCGGCCTAGACAGTAACGTGTCGCAACAGTACTGCGGG
GAAGAAGGCTCCGACTGTCTGCTCAAGGCCGCCATTGCCTGCTCGAATCCATTCAAGTTGGACATTTCCTGCAGG
TATCTGCTGGATAGTCTCATCGGCAGGGAGGTCTATCTCCGCACCATGGCCAGTGAGTCTGTACCAGTTGGCCAC
ACGTCTTCAGAGCTAACTGCGAGCTCAGGCTCGTTGAAAGTTCTGGTGGAGGAACACAAGAAGGAGTTGCAGCTA
TATAGCGATCTGGACATGGAAGCCATCGACAAGATCACATATCTCCCCGAATTTGATCGAACAGTTCAGTACGTG
ATGCCGCAATTCCCATGTATCCACCACTTTCTGACCGACTTCGCAGGTGCCCAACTTGGGGCTATCCCACAGAGC
AGGCCTATTACCGCGACGCCTCGTCGTCAGACGCCGTGCTGGCCATCAGGATTCCTTTCATGGCACTTCACGCTA
CCGACGACCCGGTAAGAAGGTTGGATCTGTCGCCATCGAAGGAAAGTCTAACGTGGGGCCAGATTGCTGTGCGCC
AGGCGATACCTTACGAGGAGTTTCAGCAGAATCCAAGCACGGTTCTCGTCACCTCTTCGCTAGGAGGCCATCTCT
GCTGGTTCGAATCGGGCGGGACCAGGTGGTTCCCTCGTCCGGTATGATGACCCGACATTGACTGCCTTCAAGCAG
CTGACTCTGATTCAGATATGCAACTTCTTCAACCGCATGGCCTTTGACGTCGACCTGGATGCCCTCAAGCCGCGG
AAGGGCCCGACGAGTCATACATCGACGGCGAAGACAACTTTTGAGCCCATGCGCCGGAAATTGAACCCCGTCGAC
ATATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail