Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3246
Gene name
LocationContig_289:20793..22344
Strand+
Gene length (bp)1551
Transcript length (bp)1365
Coding sequence length (bp)1365
Protein length (aa) 455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12311 DUF3632 Protein of unknown function (DUF3632) 3.0E-35 244 424

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup618
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|731
Ophiocordyceps australis 1348a (Ghana) OphauG2|732
Ophiocordyceps australis map64 (Brazil) OphauB2|450
Ophiocordyceps australis map64 (Brazil) OphauB2|451
Ophiocordyceps camponoti-floridani Ophcf2|01245
Ophiocordyceps camponoti-rufipedis Ophun1|3246 (this protein)
Ophiocordyceps kimflemingae Ophio5|2206
Ophiocordyceps kimflemingae Ophio5|2207

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3246
MHTLRRTTGRLPVLPRAALRIHTTAPTRLAYKDSQDRNELRPRSNEHTLSGRDDDASSADADAAFDGSQTRPEAE
KRRAGGDGAVAAGPADQGLSKPRGDERDGRDRGPGVETEKGGASRGASLVAATPRTHHQPAHDVMHRIVTILQPS
ILLPSSASNRLCPQRPPRHSAMAPPPPVDLSDLPASTSPSSANPSQHEAAIINLLSATVNDADPSARSAADALDK
LYPAGQDVGVVEDFLWSLWSLLVGTVKKIPAHDARQKLLVDIVARLRDSRDDEVELWGQKTRVWSELPMLGPCMR
DAWNLRPKPDGSDKDNAAILEWTSLNSFAARMFGADLQPWVNLAIWELRAALEEAPPSTTTARDAAIATVCEWIA
HARHQLHRQGRQPRSLDAMEERALQPGKLFEGGQSGLSDARWRFWRERLAELGPDAGSAELRDRAKTAVAQMEEL
ETST*
Coding >Ophun1|3246
ATGCACACCCTCCGCCGCACCACCGGACGCCTCCCCGTCCTCCCCCGGGCCGCTCTACGAATCCACACGACGGCC
CCCACGCGGCTCGCCTACAAGGACTCGCAGGACCGGAACGAGCTGCGGCCACGGTCCAACGAGCACACGCTCTCG
GGCCGCGACGACGACGCCTCCTCCGCCGACGCAGACGCCGCCTTCGACGGCAGCCAGACGAGGCCCGAGGCCGAA
AAGCGCCGCGCCGGAGGGGATGGTGCCGTGGCGGCCGGGCCGGCGGATCAGGGGCTCAGCAAGCCGCGCGGGGAC
GAGAGGGACGGGCGGGATCGCGGGCCCGGGGTGGAGACGGAGAAGGGAGGGGCCAGCCGGGGGGCCTCATTGGTG
GCTGCAACACCCCGCACCCACCACCAACCAGCCCACGACGTCATGCACCGCATCGTGACAATTCTCCAGCCTTCC
ATTCTGCTTCCATCCTCCGCCTCCAACCGCCTGTGCCCTCAACGCCCTCCCCGTCACTCCGCCATGGCCCCTCCC
CCGCCCGTCGACCTCTCCGACCTCCCAGCCTCGACTTCGCCCTCCTCCGCAAACCCCTCCCAGCACGAAGCCGCC
ATCATCAACCTCCTCTCCGCCACGGTCAACGACGCCGACCCCTCAGCTCGCTCCGCCGCAGACGCACTTGACAAG
CTGTACCCCGCGGGTCAGGACGTGGGGGTTGTAGAAGATTTTCTCTGGTCGTTGTGGTCGCTGCTCGTCGGTACC
GTCAAGAAGATTCCCGCCCATGACGCGAGGCAGAAGCTCCTCGTCGACATCGTTGCTCGCCTCCGCGATAGCCGC
GATGACGAGGTTGAGCTCTGGGGGCAGAAGACGAGGGTCTGGTCCGAACTGCCCATGCTTGGACCCTGCATGAGG
GACGCATGGAACCTACGCCCCAAACCCGACGGCTCCGACAAAGACAACGCCGCCATCCTCGAATGGACCTCGCTC
AACTCCTTCGCCGCCCGCATGTTCGGCGCCGACCTCCAGCCCTGGGTCAACCTAGCCATCTGGGAGCTCCGAGCC
GCCCTCGAAGAAGCACCCCCCTCGACCACGACAGCCCGAGACGCCGCCATCGCCACCGTCTGCGAGTGGATCGCC
CACGCCCGCCACCAGCTGCACCGCCAGGGCCGCCAGCCGCGCTCCCTCGACGCCATGGAGGAGAGGGCCCTCCAG
CCCGGCAAGCTGTTCGAGGGCGGGCAGTCGGGGCTCAGCGATGCCAGGTGGCGCTTCTGGCGGGAGAGGCTGGCC
GAGCTGGGGCCCGATGCTGGGAGCGCCGAGCTGAGGGACCGGGCCAAGACGGCCGTGGCCCAGATGGAGGAGCTC
GAGACTTCGACGTAG
Transcript >Ophun1|3246
ATGCACACCCTCCGCCGCACCACCGGACGCCTCCCCGTCCTCCCCCGGGCCGCTCTACGAATCCACACGACGGCC
CCCACGCGGCTCGCCTACAAGGACTCGCAGGACCGGAACGAGCTGCGGCCACGGTCCAACGAGCACACGCTCTCG
GGCCGCGACGACGACGCCTCCTCCGCCGACGCAGACGCCGCCTTCGACGGCAGCCAGACGAGGCCCGAGGCCGAA
AAGCGCCGCGCCGGAGGGGATGGTGCCGTGGCGGCCGGGCCGGCGGATCAGGGGCTCAGCAAGCCGCGCGGGGAC
GAGAGGGACGGGCGGGATCGCGGGCCCGGGGTGGAGACGGAGAAGGGAGGGGCCAGCCGGGGGGCCTCATTGGTG
GCTGCAACACCCCGCACCCACCACCAACCAGCCCACGACGTCATGCACCGCATCGTGACAATTCTCCAGCCTTCC
ATTCTGCTTCCATCCTCCGCCTCCAACCGCCTGTGCCCTCAACGCCCTCCCCGTCACTCCGCCATGGCCCCTCCC
CCGCCCGTCGACCTCTCCGACCTCCCAGCCTCGACTTCGCCCTCCTCCGCAAACCCCTCCCAGCACGAAGCCGCC
ATCATCAACCTCCTCTCCGCCACGGTCAACGACGCCGACCCCTCAGCTCGCTCCGCCGCAGACGCACTTGACAAG
CTGTACCCCGCGGGTCAGGACGTGGGGGTTGTAGAAGATTTTCTCTGGTCGTTGTGGTCGCTGCTCGTCGGTACC
GTCAAGAAGATTCCCGCCCATGACGCGAGGCAGAAGCTCCTCGTCGACATCGTTGCTCGCCTCCGCGATAGCCGC
GATGACGAGGTTGAGCTCTGGGGGCAGAAGACGAGGGTCTGGTCCGAACTGCCCATGCTTGGACCCTGCATGAGG
GACGCATGGAACCTACGCCCCAAACCCGACGGCTCCGACAAAGACAACGCCGCCATCCTCGAATGGACCTCGCTC
AACTCCTTCGCCGCCCGCATGTTCGGCGCCGACCTCCAGCCCTGGGTCAACCTAGCCATCTGGGAGCTCCGAGCC
GCCCTCGAAGAAGCACCCCCCTCGACCACGACAGCCCGAGACGCCGCCATCGCCACCGTCTGCGAGTGGATCGCC
CACGCCCGCCACCAGCTGCACCGCCAGGGCCGCCAGCCGCGCTCCCTCGACGCCATGGAGGAGAGGGCCCTCCAG
CCCGGCAAGCTGTTCGAGGGCGGGCAGTCGGGGCTCAGCGATGCCAGGTGGCGCTTCTGGCGGGAGAGGCTGGCC
GAGCTGGGGCCCGATGCTGGGAGCGCCGAGCTGAGGGACCGGGCCAAGACGGCCGTGGCCCAGATGGAGGAGCTC
GAGACTTCGACGTAG
Gene >Ophun1|3246
ATGCACACCCTCCGCCGCACCACCGGACGCCTCCCCGTCCTCCCCCGGGCCGCTCTACGAATCCACACGACGGCC
CCCACGCGGCTCGCCTACAAGGACTCGCAGGACCGGAACGAGCTGCGGCCACGGTCCAACGAGCACACGCTCTCG
GGCCGCGACGACGACGCCTCCTCCGCCGACGCAGACGCCGCCTTCGACGGCAGCCAGACGAGGCCCGAGGCCGAA
AAGCGCCGCGCCGGAGGGGATGGTGCCGTGGCGGCCGGGCCGGCGGATCAGGGGCTCAGCAAGCCGCGCGGGGAC
GAGAGGGACGGGCGGGATCGCGGGCCCGGGGTGGAGACGGAGAAGGGAGGGGCCAGCCGGGGGGGTTCGGCGCCG
AAGAGGGGGAGGCCGTAGGTGGTAGGCTTCATTCTATACATACGAAGATGTGTGTTTGTGTAGGTATCATCATGT
CCATCTCGCTTAACCCCAGCGGCCCAGCCTCATTGGTGGCTGCAACACCCCGCACCCACCACCAACCAGCCCACG
ACGTCATGCACCGCATCGTGACAATTCTCCAGCCTTCCATTCTGCTTCCATCCTCCGCCTCCAACCGCCTGTGCC
CTCAACGCCCTCCCCGTCACTCCGCCATGGCCCCTCCCCCGCCCGTCGACCTCTCCGACCTCCCAGCCTCGACTT
CGCCCTCCTCCGCAAACCCCTCCCAGCACGAAGCCGCCATCATCAACCTCCTCTCCGCCACGGTCAACGACGCCG
ACCCCTCAGCTCGCTCCGCCGCAGACGCACTTGACAAGCTGTACCCCGCGGGTCAGGACGTGGGGGTTGTAGAAG
ATTTTCTCTGGTCGTTGTGGTCGCTGCTCGTCGGTACCGTCAAGAAGATTCCCGCCCATGACGCGAGGCAGAAGC
TCCTCGTCGACATCGTTGCTCGCCTCCGCGATAGCCGCGATGACGAGGTTGAGCTCTGGGGGCAGAAGACGAGGG
TCTGGTCCGAACTGCCCATGCTTGGACCCTGCATGAGGGACGCATGGAACCGTACGTCTCTCTTCTTTTTCTCCT
TGTTCTTGTTCTTCTTCCTCTTCTCCTCTAACAAGAGTACAAATACAAGTACGCCCCAAACCCGACGGCTCCGAC
AAAGACAACGCCGCCATCCTCGAATGGACCTCGCTCAACTCCTTCGCCGCCCGCATGTTCGGCGCCGACCTCCAG
CCCTGGGTCAACCTAGCCATCTGGGAGCTCCGAGCCGCCCTCGAAGAAGCACCCCCCTCGACCACGACAGCCCGA
GACGCCGCCATCGCCACCGTCTGCGAGTGGATCGCCCACGCCCGCCACCAGCTGCACCGCCAGGGCCGCCAGCCG
CGCTCCCTCGACGCCATGGAGGAGAGGGCCCTCCAGCCCGGCAAGCTGTTCGAGGGCGGGCAGTCGGGGCTCAGC
GATGCCAGGTGGCGCTTCTGGCGGGAGAGGCTGGCCGAGCTGGGGCCCGATGCTGGGAGCGCCGAGCTGAGGGAC
CGGGCCAAGACGGCCGTGGCCCAGATGGAGGAGCTCGAGACTTCGACGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail