Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3239
Gene name
LocationContig_289:5672..6127
Strand+
Gene length (bp)455
Transcript length (bp)399
Coding sequence length (bp)399
Protein length (aa) 133

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09809 MRP-L27 Mitochondrial ribosomal protein L27 2.3E-12 66 116

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5WRL1|RM27_SCHPO 54S ribosomal protein L27, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl27 PE=3 SV=1 58 111 1.0E-10
sp|P36526|RM27_YEAST 54S ribosomal protein L27, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL27 PE=1 SV=2 66 116 2.0E-10

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005762 mitochondrial large ribosomal subunit Yes
GO:1990904 ribonucleoprotein complex No
GO:0015934 large ribosomal subunit No
GO:0000315 organellar large ribosomal subunit No
GO:0098798 mitochondrial protein-containing complex No
GO:0003674 molecular_function No
GO:0044391 ribosomal subunit No
GO:0005575 cellular_component No
GO:0005198 structural molecule activity No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2622
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|739
Ophiocordyceps australis map64 (Brazil) OphauB2|443
Ophiocordyceps camponoti-floridani Ophcf2|01251
Ophiocordyceps camponoti-rufipedis Ophun1|3239 (this protein)
Ophiocordyceps kimflemingae Ophio5|2199
Ophiocordyceps subramaniannii Hirsu2|4001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3239
MQRKQTDRNEGALFSDANCQLFKPTTDSKGIQIQHPLNQQQQQQQQQQQQQGAMRPTQALLVGRYRHLRLTTKDV
GKGYYKGNRTGSMGQHTKYGGYQIEWAKVRTYVVPNLESFKAGFLFGGASSSSRFAG*
Coding >Ophun1|3239
ATGCAGAGGAAGCAAACAGACAGAAATGAGGGCGCGTTGTTCTCCGACGCCAACTGCCAACTTTTCAAACCGACG
ACAGACAGCAAGGGGATCCAGATCCAGCATCCGCTCAATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGGGCGCCATGAGGCCAACACAGGCCCTCCTCGTCGGGCGCTACCGCCACCTCCGGCTGACAACAAAGGACGTC
GGCAAGGGCTACTACAAGGGCAACCGGACGGGATCCATGGGCCAGCACACGAAATACGGAGGCTATCAGATTGAA
TGGGCAAAGGTGCGCACGTACGTGGTGCCCAACCTGGAGTCGTTCAAGGCAGGTTTTCTATTCGGGGGTGCGTCG
TCGTCGTCGAGGTTCGCGGGCTGA
Transcript >Ophun1|3239
ATGCAGAGGAAGCAAACAGACAGAAATGAGGGCGCGTTGTTCTCCGACGCCAACTGCCAACTTTTCAAACCGACG
ACAGACAGCAAGGGGATCCAGATCCAGCATCCGCTCAATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAG
CAGGGCGCCATGAGGCCAACACAGGCCCTCCTCGTCGGGCGCTACCGCCACCTCCGGCTGACAACAAAGGACGTC
GGCAAGGGCTACTACAAGGGCAACCGGACGGGATCCATGGGCCAGCACACGAAATACGGAGGCTATCAGATTGAA
TGGGCAAAGGTGCGCACGTACGTGGTGCCCAACCTGGAGTCGTTCAAGGCAGGTTTTCTATTCGGGGGTGCGTCG
TCGTCGTCGAGGTTCGCGGGCTGA
Gene >Ophun1|3239
ATGCAGAGGAAGCAAACAGACAGAAATGAGGGCGCGTTGTTGTCAGTGATGTCAAGACCTCGGAGCGGAACAACG
CCCTCCGCCGATCGATAAGCAGCTCCGACGCCAACTGCCAACTTTTCAAACCGACGACAGACAGCAAGGGGATCC
AGATCCAGCATCCGCTCAATCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGGCGCCATGAGGCCAA
CACAGGCCCTCCTCGTCGGGCGCTACCGCCACCTCCGGCTGACAACAAAGGACGTCGGCAAGGGCTACTACAAGG
GCAACCGGACGGGATCCATGGGCCAGCACACGAAATACGGAGGCTATCAGATTGAATGGGCAAAGGTGCGCACGT
ACGTGGTGCCCAACCTGGAGTCGTTCAAGGCAGGTTTTCTATTCGGGGGTGCGTCGTCGTCGTCGAGGTTCGCGG
GCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail