Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3233
Gene name
LocationContig_288:12004..13710
Strand+
Gene length (bp)1706
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08598 Sds3 Sds3-like 1.0E-23 32 235

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3859
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3902
Ophiocordyceps australis map64 (Brazil) OphauB2|6517
Ophiocordyceps camponoti-floridani Ophcf2|06608
Ophiocordyceps camponoti-rufipedis Ophun1|3233 (this protein)
Ophiocordyceps kimflemingae Ophio5|5011
Ophiocordyceps subramaniannii Hirsu2|7647

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3233
MAASDPVLPLALAASRAESSQSKRDRKRQVVMERLAALTDKFQHDKDSAYRDQLQRIQLELNKLQKFDPYASNAV
EVAGEVQREYKQATAMTVRAENARSLMDMAGLQFPQFMSDVQDVLEARDYQLTQSKNDYERKVQQYKNTHIFKME
TAKREHHALNSTMRDRLVNHLNTKKARLVKEKEAFETSDSHALLLNPNQFHLPGPGSPGGHPGKRSTRNRKEAAD
NHDGFGESKKRKRNAGDDDGSPAPTRRALDPSVTTPYWQSEKARIEARKQGPPYSLASLFTEKELSMHYNTAALA
SHNHILRHRSIGNDSSASQGISDSGNADHEAGDGDAQLQPPSSSAPAMERQPSHATRSTRVAAQSNFSDDKLFGI
EGIGTFELPSNLDLMHGPECTPKMPAVPPYPPYTKVSSKGEQSLPNALSEKEVAMDFQIMACLKQYDVGRCPGSH
LDNPKGLRKTFEAIATPYQAGRFMSLAKVSRENEAEVLRESFGVGLPTSSVRDQSSPGRGVNGQATGGTPMSRQS
SAGGVAMSRQGTAGSGRTKTRRG*
Coding >Ophun1|3233
ATGGCTGCGAGCGACCCCGTTCTCCCCTTGGCCCTGGCTGCCAGCCGAGCCGAGTCGTCGCAGTCCAAGAGAGAT
CGCAAGCGCCAGGTCGTCATGGAGCGCCTCGCCGCCCTGACGGATAAGTTCCAGCACGACAAGGATTCGGCCTAC
CGTGATCAGCTCCAGCGGATCCAGTTGGAGCTCAACAAGCTACAGAAGTTCGACCCCTACGCCTCCAACGCCGTC
GAGGTCGCTGGCGAGGTCCAGCGTGAATACAAGCAGGCTACGGCCATGACTGTGCGCGCCGAAAACGCCCGGAGC
CTGATGGATATGGCTGGCCTGCAGTTTCCTCAGTTCATGTCTGACGTTCAGGACGTTCTCGAGGCTCGCGATTAC
CAGCTTACGCAGTCCAAGAATGACTACGAGCGCAAGGTGCAACAGTACAAGAATACGCACATTTTCAAGATGGAG
ACGGCCAAGCGGGAGCACCATGCCCTCAACTCGACCATGCGCGACCGGCTGGTCAACCACCTCAATACCAAGAAA
GCTCGGCTGGTGAAGGAGAAGGAGGCCTTTGAGACGAGCGACTCCCATGCGCTGCTCCTCAATCCCAACCAGTTC
CACCTCCCGGGCCCCGGCAGCCCCGGCGGGCATCCTGGGAAGCGATCGACGCGGAACCGCAAGGAGGCTGCCGAT
AACCACGACGGCTTCGGAGAGAGCAAGAAGCGGAAGCGCAATGCTGGTGACGACGATGGTTCACCTGCGCCGACG
CGACGGGCGCTGGACCCGAGCGTCACGACGCCCTACTGGCAGTCGGAGAAGGCCCGGATCGAGGCCAGGAAGCAG
GGGCCTCCATACAGCCTCGCAAGCCTCTTTACGGAAAAGGAGCTTTCAATGCACTACAACACGGCGGCGCTCGCG
TCCCACAACCACATCCTTCGTCACCGCTCCATCGGCAACGACTCGTCGGCTTCTCAAGGGATTAGCGACTCTGGC
AACGCTGACCACGAGGCAGGCGACGGCGATGCTCAGCTACAGCCGCCGTCGTCGTCGGCGCCCGCCATGGAACGT
CAGCCGTCGCACGCCACTCGAAGCACGCGGGTGGCGGCCCAGAGCAACTTTTCAGACGACAAGTTGTTTGGGATT
GAGGGCATCGGAACCTTTGAGCTTCCGTCGAACCTGGACCTGATGCACGGGCCCGAATGCACGCCCAAGATGCCA
GCAGTGCCGCCCTATCCGCCATATACCAAGGTCAGCTCCAAGGGAGAGCAATCGCTTCCGAACGCGCTGTCGGAG
AAGGAAGTGGCCATGGACTTTCAAATCATGGCCTGTCTGAAGCAATACGACGTCGGACGCTGCCCGGGGAGCCAC
CTGGACAACCCCAAGGGTCTGCGGAAGACATTCGAGGCCATTGCGACGCCTTACCAGGCGGGCAGGTTCATGTCG
CTGGCCAAGGTGAGCCGCGAGAACGAGGCCGAAGTGTTGCGGGAATCGTTTGGCGTCGGATTGCCCACCAGCAGC
GTGCGCGATCAGTCGAGTCCGGGACGAGGCGTCAACGGACAGGCGACGGGGGGCACGCCGATGAGCCGACAGAGC
AGCGCGGGCGGCGTGGCCATGAGCCGACAGGGGACGGCGGGTAGCGGACGGACCAAGACGAGGAGAGGATAG
Transcript >Ophun1|3233
ATGGCTGCGAGCGACCCCGTTCTCCCCTTGGCCCTGGCTGCCAGCCGAGCCGAGTCGTCGCAGTCCAAGAGAGAT
CGCAAGCGCCAGGTCGTCATGGAGCGCCTCGCCGCCCTGACGGATAAGTTCCAGCACGACAAGGATTCGGCCTAC
CGTGATCAGCTCCAGCGGATCCAGTTGGAGCTCAACAAGCTACAGAAGTTCGACCCCTACGCCTCCAACGCCGTC
GAGGTCGCTGGCGAGGTCCAGCGTGAATACAAGCAGGCTACGGCCATGACTGTGCGCGCCGAAAACGCCCGGAGC
CTGATGGATATGGCTGGCCTGCAGTTTCCTCAGTTCATGTCTGACGTTCAGGACGTTCTCGAGGCTCGCGATTAC
CAGCTTACGCAGTCCAAGAATGACTACGAGCGCAAGGTGCAACAGTACAAGAATACGCACATTTTCAAGATGGAG
ACGGCCAAGCGGGAGCACCATGCCCTCAACTCGACCATGCGCGACCGGCTGGTCAACCACCTCAATACCAAGAAA
GCTCGGCTGGTGAAGGAGAAGGAGGCCTTTGAGACGAGCGACTCCCATGCGCTGCTCCTCAATCCCAACCAGTTC
CACCTCCCGGGCCCCGGCAGCCCCGGCGGGCATCCTGGGAAGCGATCGACGCGGAACCGCAAGGAGGCTGCCGAT
AACCACGACGGCTTCGGAGAGAGCAAGAAGCGGAAGCGCAATGCTGGTGACGACGATGGTTCACCTGCGCCGACG
CGACGGGCGCTGGACCCGAGCGTCACGACGCCCTACTGGCAGTCGGAGAAGGCCCGGATCGAGGCCAGGAAGCAG
GGGCCTCCATACAGCCTCGCAAGCCTCTTTACGGAAAAGGAGCTTTCAATGCACTACAACACGGCGGCGCTCGCG
TCCCACAACCACATCCTTCGTCACCGCTCCATCGGCAACGACTCGTCGGCTTCTCAAGGGATTAGCGACTCTGGC
AACGCTGACCACGAGGCAGGCGACGGCGATGCTCAGCTACAGCCGCCGTCGTCGTCGGCGCCCGCCATGGAACGT
CAGCCGTCGCACGCCACTCGAAGCACGCGGGTGGCGGCCCAGAGCAACTTTTCAGACGACAAGTTGTTTGGGATT
GAGGGCATCGGAACCTTTGAGCTTCCGTCGAACCTGGACCTGATGCACGGGCCCGAATGCACGCCCAAGATGCCA
GCAGTGCCGCCCTATCCGCCATATACCAAGGTCAGCTCCAAGGGAGAGCAATCGCTTCCGAACGCGCTGTCGGAG
AAGGAAGTGGCCATGGACTTTCAAATCATGGCCTGTCTGAAGCAATACGACGTCGGACGCTGCCCGGGGAGCCAC
CTGGACAACCCCAAGGGTCTGCGGAAGACATTCGAGGCCATTGCGACGCCTTACCAGGCGGGCAGGTTCATGTCG
CTGGCCAAGGTGAGCCGCGAGAACGAGGCCGAAGTGTTGCGGGAATCGTTTGGCGTCGGATTGCCCACCAGCAGC
GTGCGCGATCAGTCGAGTCCGGGACGAGGCGTCAACGGACAGGCGACGGGGGGCACGCCGATGAGCCGACAGAGC
AGCGCGGGCGGCGTGGCCATGAGCCGACAGGGGACGGCGGGTAGCGGACGGACCAAGACGAGGAGAGGATAG
Gene >Ophun1|3233
ATGGCTGCGAGCGACCCCGTTCTCCCCTTGGCCCTGGCTGCCAGCCGAGCCGAGTCGTCGCAGTCCAAGAGAGAT
CGCAAGCGCCAGGTCGTCATGGAGCGCCTCGCCGCCCTGACGGATAAGTTCCAGCACGACAAGGATTCGGCCTAC
CGTGATCAGCTCCAGCGGATCCAGTTGGAGCTCAACAAGCTACAGAAGTTCGACCCCTACGCCTCCAACGCCGTC
GAGGTCGCTGGCGAGGTCCAGCGTGAATACAAGCAGGCTACGGCCATGACTGTGCGCGCCGAAAACGCCCGGAGC
CTGATGGATATGGCTGGCCTGCAGTTTCCTCAGTTCATGTCTGACGTTCAGGACGTTCTCGAGGCTCGCGATTAC
CAGCTTACGCAGTCCAAGGTAAGAGGGCAGAAATGCGCTGCTGATGTTGGCTGTTTGCTAATTGTTTGCCGCGAC
AGAATGACTACGAGCGCAAGGTGCAACAGTACAAGAATACGCACATTTTCAAGATGGAGACGGCCAAGCGGGAGC
ACCATGCCCTCAACTCGACCATGCGCGACCGGCTGGTCAACCACCTCAATACCAAGAAAGCTCGGCTGGTGAAGG
AGAAGGAGGCCTTTGAGACGAGCGACTCCCATGCGCTGCTCCTCAATCCCAACCAGTTCCACCTCCCGGGCCCCG
GCAGCCCCGGCGGGCATCCTGGGAAGCGATCGACGCGGAACCGCAAGGAGGCTGCCGATAACCACGACGGCTTCG
GAGAGAGCAAGAAGCGGAAGCGCAATGCTGGTGACGACGATGGTTCACCTGCGCCGACGCGACGGGCGCTGGACC
CGAGCGTCACGACGCCCTACTGGCAGTCGGAGAAGGCCCGGATCGAGGCCAGGAAGCAGGGGCCTCCATACAGCC
TCGCAAGCCTCTTTACGGAAAAGGAGCTTTCAATGCACTACAACACGGCGGCGCTCGCGTCCCACAACCACATCC
TTCGTCACCGCTCCATCGGCAACGACTCGTCGGCTTCTCAAGGGATTAGCGACTCTGGCAACGCTGACCACGAGG
CAGGCGACGGCGATGCTCAGCTACAGCCGCCGTCGTCGTCGGCGCCCGCCATGGAACGTCAGCCGTCGCACGCCA
CTCGAAGCACGCGGGTGGCGGCCCAGAGCAACTTTTCAGACGACAAGTTGTTTGGGATTGAGGGCATCGGAACCT
TTGAGCTTCCGTCGAACCTGGACCTGATGCACGGGCCCGAATGCACGCCCAAGATGCCAGCAGTGCCGCCCTATC
CGCCATATACCAAGGTCAGCTCCAAGGGAGAGCAATCGCTTCCGAACGCGCTGTCGGAGAAGGAAGTGGCCATGG
ACTTTCAAATCATGGCCTGTCTGAAGCAATACGACGTCGGACGCTGCCCGGGGAGCCACCTGGACAACCCCAAGG
GTCTGCGGAAGACATTCGAGGCCATTGCGACGCCTTACCAGGCGGGCAGGTTCATGTCGCTGGCCAAGGTGAGCC
GCGAGAACGAGGCCGAAGTGTTGCGGGAATCGTTTGGCGTCGGATTGCCCACCAGCAGCGTGCGCGATCAGTCGA
GTCCGGGACGAGGCGTCAACGGACAGGCGACGGGGGGCACGCCGATGAGCCGACAGAGCAGCGCGGGCGGCGTGG
CCATGAGCCGACAGGGGACGGCGGGTAGCGGACGGACCAAGACGAGGAGAGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail