Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3231
Gene name
LocationContig_288:8902..9817
Strand-
Gene length (bp)915
Transcript length (bp)792
Coding sequence length (bp)792
Protein length (aa) 264

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01168 Ala_racemase_N Alanine racemase, N-terminal domain 1.3E-21 28 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6Q1|YKC9_SCHPO UPF0001 protein C644.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.09 PE=3 SV=1 25 261 8.0E-58
sp|P38197|YBD6_YEAST UPF0001 protein YBL036C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBL036C PE=1 SV=1 11 261 1.0E-55
sp|P52057|PROSC_CAEEL Proline synthase co-transcribed bacterial homolog protein OS=Caenorhabditis elegans GN=F09E5.8 PE=3 SV=1 16 257 3.0E-45
sp|Q1ZXI6|PROSC_DICDI Proline synthase co-transcribed bacterial homolog protein OS=Dictyostelium discoideum GN=prosc PE=3 SV=2 10 253 2.0E-44
sp|O94903|PROSC_HUMAN Proline synthase co-transcribed bacterial homolog protein OS=Homo sapiens GN=PROSC PE=1 SV=1 39 253 2.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6Q1|YKC9_SCHPO UPF0001 protein C644.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.09 PE=3 SV=1 25 261 8.0E-58
sp|P38197|YBD6_YEAST UPF0001 protein YBL036C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBL036C PE=1 SV=1 11 261 1.0E-55
sp|P52057|PROSC_CAEEL Proline synthase co-transcribed bacterial homolog protein OS=Caenorhabditis elegans GN=F09E5.8 PE=3 SV=1 16 257 3.0E-45
sp|Q1ZXI6|PROSC_DICDI Proline synthase co-transcribed bacterial homolog protein OS=Dictyostelium discoideum GN=prosc PE=3 SV=2 10 253 2.0E-44
sp|O94903|PROSC_HUMAN Proline synthase co-transcribed bacterial homolog protein OS=Homo sapiens GN=PROSC PE=1 SV=1 39 253 2.0E-44
sp|Q3T0G5|PROSC_BOVIN Proline synthase co-transcribed bacterial homolog protein OS=Bos taurus GN=PROSC PE=2 SV=1 39 253 2.0E-44
sp|Q5R4Z1|PROSC_PONAB Proline synthase co-transcribed bacterial homolog protein OS=Pongo abelii GN=PROSC PE=2 SV=1 39 253 2.0E-43
sp|Q9Z2Y8|PROSC_MOUSE Proline synthase co-transcribed bacterial homolog protein OS=Mus musculus GN=Prosc PE=1 SV=1 39 253 3.0E-41
sp|P52055|YPI1_VIBAL UPF0001 protein in pilT-proC intergenic region OS=Vibrio alginolyticus PE=3 SV=1 28 253 7.0E-26
sp|P24562|Y394_PSEAE UPF0001 protein PA0394 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA0394 PE=3 SV=1 22 253 9.0E-26
sp|Q9KUQ4|Y461_VIBCH UPF0001 protein VC_0461 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_0461 PE=3 SV=1 30 259 8.0E-25
sp|P44506|Y090_HAEIN UPF0001 protein HI_0090 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0090 PE=1 SV=1 22 253 1.0E-24
sp|Q9CPD5|Y112_PASMU UPF0001 protein PM0112 OS=Pasteurella multocida (strain Pm70) GN=PM0112 PE=3 SV=1 38 253 2.0E-24
sp|P67081|YGGS_ECOL6 UPF0001 protein YggS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=yggS PE=3 SV=1 22 253 4.0E-24
sp|P67082|YGGS_ECO57 UPF0001 protein YggS OS=Escherichia coli O157:H7 GN=yggS PE=3 SV=1 22 253 4.0E-24
sp|P67080|YGGS_ECOLI UPF0001 protein YggS OS=Escherichia coli (strain K12) GN=yggS PE=1 SV=1 22 253 4.0E-24
sp|O25156|Y395_HELPY UPF0001 protein HP_0395 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=HP_0395 PE=3 SV=1 14 250 6.0E-23
sp|Q9ZKF2|Y395_HELPJ UPF0001 protein jhp_0986 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=jhp_0986 PE=3 SV=1 14 250 1.0E-21
sp|O66631|Y274_AQUAE UPF0001 protein aq_274 OS=Aquifex aeolicus (strain VF5) GN=aq_274 PE=3 SV=1 20 253 1.0E-18
sp|Q89A48|Y497_BUCBP UPF0001 protein bbp_497 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_497 PE=3 SV=1 16 252 9.0E-18
sp|P67084|Y2172_MYCBO UPF0001 protein Mb2172c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2172c PE=3 SV=1 12 257 4.0E-17
sp|P9WFQ7|Y2148_MYCTU UPF0001 protein Rv2148c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2148c PE=1 SV=1 12 257 4.0E-17
sp|P9WFQ6|Y2148_MYCTO UPF0001 protein MT2207 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2207 PE=3 SV=1 12 257 4.0E-17
sp|Q9CCE2|Y919_MYCLE UPF0001 protein ML0919 OS=Mycobacterium leprae (strain TN) GN=ML0919 PE=3 SV=2 14 251 7.0E-17
sp|P52056|Y556_SYNY3 UPF0001 protein slr0556 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0556 PE=3 SV=1 37 253 9.0E-14
sp|O31727|YLME_BACSU UPF0001 protein YlmE OS=Bacillus subtilis (strain 168) GN=ylmE PE=3 SV=1 65 251 1.0E-13
sp|O24748|Y2153_CORGL UPF0001 protein Cgl2153/cg2364 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl2153 PE=3 SV=2 37 254 2.0E-13
sp|Q9RUL6|Y1368_DEIRA UPF0001 protein DR_1368 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1368 PE=3 SV=1 37 250 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3231
MSETSDEMRIDPARAEALISRLASVKDRIAAQAQGRNVRLVAVSKLKPANDILALHREPGSHVHFGENYAQELSQ
KADLLPRSIQWHYIGGLQSGRCKILAKIPNLFCVSSVDSSKKAHLLESARAELLASDSSLPKLSVHVQVNTSAEE
AKSGCPPGAETVALCREIVESCPSLRLLGLMTIGAIARSKAAAEGDVNEDFVSLTKQRDLVVKELGLAPESLELS
MGMSEDFEGAIAMGSGEVRIGSTIFGLRPAKSDAKIQE*
Coding >Ophun1|3231
ATGAGCGAGACCTCTGACGAGATGCGCATCGATCCCGCCCGCGCCGAAGCTCTCATATCCCGCCTGGCCTCGGTC
AAAGACCGCATCGCCGCCCAAGCCCAAGGACGAAATGTCCGTCTCGTCGCCGTCTCCAAGCTCAAGCCAGCAAAC
GACATCCTCGCCCTACACCGAGAACCAGGCTCGCACGTCCACTTTGGCGAGAACTACGCTCAGGAACTGAGTCAA
AAGGCCGATCTCCTCCCCCGCTCCATCCAATGGCATTACATCGGCGGCCTGCAGTCTGGCCGCTGTAAAATTCTG
GCCAAGATCCCCAACCTCTTCTGCGTCTCCAGCGTCGACTCCTCCAAGAAAGCCCACCTCCTCGAATCCGCCCGA
GCCGAGCTCCTCGCTTCGGACTCCTCGCTACCCAAGCTCTCGGTTCACGTCCAGGTCAACACGTCGGCCGAGGAG
GCCAAGTCCGGCTGCCCGCCCGGCGCCGAGACCGTCGCTCTGTGCCGCGAAATCGTCGAGTCGTGCCCTAGCCTC
CGTCTACTCGGTCTCATGACTATCGGTGCCATCGCCCGCAGCAAGGCCGCTGCCGAGGGCGACGTCAATGAGGAT
TTCGTCTCTCTGACGAAGCAGCGGGACCTGGTCGTCAAGGAGCTTGGCTTGGCTCCGGAGAGCCTCGAGCTGAGC
ATGGGCATGAGTGAAGACTTTGAGGGCGCCATTGCCATGGGGAGCGGCGAGGTTAGGATTGGCAGCACCATCTTT
GGCCTTCGGCCGGCCAAGTCGGATGCCAAGATTCAAGAATGA
Transcript >Ophun1|3231
ATGAGCGAGACCTCTGACGAGATGCGCATCGATCCCGCCCGCGCCGAAGCTCTCATATCCCGCCTGGCCTCGGTC
AAAGACCGCATCGCCGCCCAAGCCCAAGGACGAAATGTCCGTCTCGTCGCCGTCTCCAAGCTCAAGCCAGCAAAC
GACATCCTCGCCCTACACCGAGAACCAGGCTCGCACGTCCACTTTGGCGAGAACTACGCTCAGGAACTGAGTCAA
AAGGCCGATCTCCTCCCCCGCTCCATCCAATGGCATTACATCGGCGGCCTGCAGTCTGGCCGCTGTAAAATTCTG
GCCAAGATCCCCAACCTCTTCTGCGTCTCCAGCGTCGACTCCTCCAAGAAAGCCCACCTCCTCGAATCCGCCCGA
GCCGAGCTCCTCGCTTCGGACTCCTCGCTACCCAAGCTCTCGGTTCACGTCCAGGTCAACACGTCGGCCGAGGAG
GCCAAGTCCGGCTGCCCGCCCGGCGCCGAGACCGTCGCTCTGTGCCGCGAAATCGTCGAGTCGTGCCCTAGCCTC
CGTCTACTCGGTCTCATGACTATCGGTGCCATCGCCCGCAGCAAGGCCGCTGCCGAGGGCGACGTCAATGAGGAT
TTCGTCTCTCTGACGAAGCAGCGGGACCTGGTCGTCAAGGAGCTTGGCTTGGCTCCGGAGAGCCTCGAGCTGAGC
ATGGGCATGAGTGAAGACTTTGAGGGCGCCATTGCCATGGGGAGCGGCGAGGTTAGGATTGGCAGCACCATCTTT
GGCCTTCGGCCGGCCAAGTCGGATGCCAAGATTCAAGAATGA
Gene >Ophun1|3231
ATGAGCGAGACCTCTGACGAGATGCGCATCGATCCCGCCCGCGCCGAAGCTCTCATATCCCGCCTGGCCTCGGTC
AAAGACCGCATCGCCGCCCAAGCCCAAGGACGAAATGTACCTATATACCGCTACGTCGAGGGCACAAGAGAACAT
AAAGATGCTGACTCCCGCTCAATAGGTCCGTCTCGTCGCCGTCTCCAAGCTCAAGCCAGCAAACGACATCCTCGC
CCTACACCGAGAACCAGGCTCGCACGTCCACTTTGGCGAGAACTACGCTCAGGAACTGAGTCAAAAGGCCGATCT
CCTCCCCCGCTCCATCCAATGGCATTACATCGGCGGCCTGCAGTCTGGTGAGCTTCTTCTTCTCCTCTCGATCCC
GTATCTAGCTGACCGCATCGCCTCTCAAAAGGCCGCTGTAAAATTCTGGCCAAGATCCCCAACCTCTTCTGCGTC
TCCAGCGTCGACTCCTCCAAGAAAGCCCACCTCCTCGAATCCGCCCGAGCCGAGCTCCTCGCTTCGGACTCCTCG
CTACCCAAGCTCTCGGTTCACGTCCAGGTCAACACGTCGGCCGAGGAGGCCAAGTCCGGCTGCCCGCCCGGCGCC
GAGACCGTCGCTCTGTGCCGCGAAATCGTCGAGTCGTGCCCTAGCCTCCGTCTACTCGGTCTCATGACTATCGGT
GCCATCGCCCGCAGCAAGGCCGCTGCCGAGGGCGACGTCAATGAGGATTTCGTCTCTCTGACGAAGCAGCGGGAC
CTGGTCGTCAAGGAGCTTGGCTTGGCTCCGGAGAGCCTCGAGCTGAGCATGGGCATGAGTGAAGACTTTGAGGGC
GCCATTGCCATGGGGAGCGGCGAGGTTAGGATTGGCAGCACCATCTTTGGCCTTCGGCCGGCCAAGTCGGATGCC
AAGATTCAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail