Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3229
Gene name
LocationContig_288:3848..4944
Strand-
Gene length (bp)1096
Transcript length (bp)1038
Coding sequence length (bp)1038
Protein length (aa) 346

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 1.6E-10 117 191
PF13489 Methyltransf_23 Methyltransferase domain 5.0E-09 65 248
PF08242 Methyltransf_12 Methyltransferase domain 9.2E-09 85 192
PF13649 Methyltransf_25 Methyltransferase domain 4.1E-08 84 191
PF13847 Methyltransf_31 Methyltransferase domain 1.3E-06 83 192

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5TEU4|NDUF5_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Homo sapiens GN=NDUFAF5 PE=1 SV=1 11 342 7.0E-90
sp|Q5RBS1|NDUF5_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Pongo abelii GN=NDUFAF5 PE=2 SV=1 9 342 2.0E-89
sp|A3KP37|NDUF5_DANRE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Danio rerio GN=ndufaf5 PE=2 SV=1 34 342 2.0E-88
sp|A2APY7|NDUF5_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Mus musculus GN=Ndufaf5 PE=1 SV=1 27 342 1.0E-86
sp|B2GV71|NDUF5_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Rattus norvegicus GN=Ndufaf5 PE=2 SV=1 27 342 1.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5TEU4|NDUF5_HUMAN NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Homo sapiens GN=NDUFAF5 PE=1 SV=1 11 342 7.0E-90
sp|Q5RBS1|NDUF5_PONAB NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Pongo abelii GN=NDUFAF5 PE=2 SV=1 9 342 2.0E-89
sp|A3KP37|NDUF5_DANRE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Danio rerio GN=ndufaf5 PE=2 SV=1 34 342 2.0E-88
sp|A2APY7|NDUF5_MOUSE NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Mus musculus GN=Ndufaf5 PE=1 SV=1 27 342 1.0E-86
sp|B2GV71|NDUF5_RAT NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Rattus norvegicus GN=Ndufaf5 PE=2 SV=1 27 342 1.0E-86
sp|Q54JW0|NDUF5_DICDI NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 5 OS=Dictyostelium discoideum GN=ndufaf5 PE=3 SV=1 29 342 6.0E-70
sp|O80543|Y1280_ARATH Putative methyltransferase At1g22800 OS=Arabidopsis thaliana GN=At1g22800 PE=2 SV=2 31 342 2.0E-68
sp|A1WVM4|BIOC_HALHL Malonyl-[acyl-carrier protein] O-methyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=bioC PE=3 SV=1 35 320 3.0E-28
sp|C1D5S5|BIOC_LARHH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=bioC PE=3 SV=1 47 344 2.0E-27
sp|D9SJ16|BIOC_GALCS Malonyl-[acyl-carrier protein] O-methyltransferase OS=Gallionella capsiferriformans (strain ES-2) GN=bioC PE=3 SV=1 48 332 1.0E-26
sp|E4QJB8|BIOC_METS6 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Methylovorus sp. (strain MP688) GN=bioC PE=3 SV=1 47 340 6.0E-26
sp|Q2Y9Y6|BIOC_NITMU Malonyl-[acyl-carrier protein] O-methyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=bioC PE=3 SV=1 47 334 8.0E-25
sp|B2IAI0|BIOC_XYLF2 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=bioC PE=3 SV=1 45 320 1.0E-23
sp|Q9ZD84|Y459_RICPR Putative methyltransferase RP459 OS=Rickettsia prowazekii (strain Madrid E) GN=RP459 PE=3 SV=1 104 277 3.0E-23
sp|C5BMZ8|BIOHC_TERTT Biotin biosynthesis bifunctional protein BioHC OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=bioC PE=3 SV=1 68 317 8.0E-17
sp|Q83E64|BIOC1_COXBU Malonyl-[acyl-carrier protein] O-methyltransferase 1 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=bioC1 PE=3 SV=1 66 328 3.0E-16
sp|Q5ZT34|BIOC_LEGPH Malonyl-[acyl-carrier protein] O-methyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=bioC PE=3 SV=2 50 321 7.0E-15
sp|Q21FY5|BIOHC_SACD2 Biotin biosynthesis bifunctional protein BioHC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=bioC PE=3 SV=1 119 316 7.0E-15
sp|A6UYW3|BIOC_PSEA7 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=bioC PE=3 SV=1 83 318 3.0E-14
sp|Q749W5|BIOC_GEOSL Malonyl-[acyl-carrier protein] O-methyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=bioC PE=3 SV=1 83 321 2.0E-13
sp|Q609U9|BIOC_METCA Malonyl-[acyl-carrier protein] O-methyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=bioC PE=3 SV=1 64 315 2.0E-13
sp|P36571|BIOC_SERMA Malonyl-[acyl-carrier protein] O-methyltransferase OS=Serratia marcescens GN=bioC PE=1 SV=1 148 322 4.0E-11
sp|E3HCT1|BIOC2_ILYPC Malonyl-[acyl-carrier protein] O-methyltransferase 2 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=bioC2 PE=3 SV=1 113 318 5.0E-09
sp|A4G5P1|BIOC_HERAR Malonyl-[acyl-carrier protein] O-methyltransferase OS=Herminiimonas arsenicoxydans GN=bioC PE=3 SV=1 62 317 6.0E-09
sp|B3PI89|BIOHC_CELJU Biotin biosynthesis bifunctional protein BioHC OS=Cellvibrio japonicus (strain Ueda107) GN=bioC PE=3 SV=1 114 318 5.0E-08
sp|D2T333|BIOC_ERWP6 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=bioC PE=3 SV=1 151 298 7.0E-08
sp|Q47C02|BIOC_DECAR Malonyl-[acyl-carrier protein] O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=bioC PE=3 SV=1 147 317 1.0E-07
sp|Q7CH67|BIOC_YERPE Malonyl-[acyl-carrier protein] O-methyltransferase OS=Yersinia pestis GN=bioC PE=3 SV=1 148 322 2.0E-07
sp|Q9K623|BIOC_BACHD Malonyl-[acyl-carrier protein] O-methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bioC PE=3 SV=1 60 318 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3229
MSVRCLGASAAWRKPSPSIFRRSYAVASAGAPRFQVFNRRTKWLHKERAASRPDESRQADYLKDEVAARLTDRLL
DIKRHFPRVLDLGANSCNIARALVKTTSDASKPDLPPPSSRIGELVAVDSSETLLYRDAHDEFNTKLNITRRVLE
DEESIPFEPQSFDLVLSSLSLHWINDLPGILTQINNVLKPDCPFVGAILGGDTLFELRTSLQLAEQERMGGMSPH
VSPLADVRDVGGLLQKAGFKMLTVDVDDIIVDYPDTFALMQDLQAMAENNAVLGREMGPIRRDVLLANEAIYRSL
HGNADGSIPATFRIIYMIGWREDANQPKPLPRGSAEVNLKDVLEK*
Coding >Ophun1|3229
ATGTCAGTGCGTTGCCTCGGAGCCTCAGCCGCATGGCGCAAGCCGTCCCCGTCCATCTTCCGCCGAAGCTACGCC
GTTGCCTCGGCCGGAGCTCCGCGCTTCCAGGTCTTCAACCGGCGCACCAAGTGGTTGCACAAGGAGCGGGCCGCC
TCGAGACCCGATGAGAGCCGTCAGGCCGACTATCTAAAGGATGAGGTCGCCGCGAGGTTGACTGACAGGTTGCTT
GATATCAAGCGTCATTTTCCCCGTGTGCTCGACCTGGGAGCGAACTCGTGCAACATCGCCCGAGCCTTGGTCAAG
ACCACGTCAGATGCGTCGAAGCCTGATTTGCCGCCGCCGTCTTCGAGGATAGGGGAGCTCGTGGCCGTTGACTCG
TCCGAGACTCTCCTATATCGCGACGCCCACGACGAATTCAACACCAAGCTTAACATCACTCGACGGGTGTTGGAA
GACGAAGAGAGCATACCGTTCGAACCCCAGTCGTTTGATCTGGTCTTGAGTTCGCTCAGCCTGCACTGGATCAAC
GATCTGCCCGGCATCCTGACGCAGATCAACAACGTTCTCAAGCCCGACTGCCCTTTTGTTGGTGCCATTCTCGGC
GGCGATACGTTGTTCGAGCTGCGGACCTCCCTCCAACTGGCCGAGCAGGAACGTATGGGCGGAATGTCGCCTCAT
GTCTCCCCTCTGGCCGACGTGCGCGACGTTGGCGGCCTCTTACAAAAGGCCGGATTCAAGATGTTGACGGTCGAT
GTTGACGACATCATCGTCGACTACCCAGATACCTTTGCTCTGATGCAGGATCTGCAAGCCATGGCCGAGAATAAT
GCCGTCCTGGGAAGGGAAATGGGGCCGATTCGCAGAGACGTCCTCTTGGCCAATGAGGCCATCTACAGGTCGCTT
CATGGCAACGCCGACGGATCTATTCCAGCCACTTTTCGCATCATATACATGATTGGCTGGCGTGAAGACGCCAAC
CAGCCGAAGCCGTTGCCAAGGGGCAGCGCCGAAGTGAACCTGAAAGATGTATTGGAAAAGTGA
Transcript >Ophun1|3229
ATGTCAGTGCGTTGCCTCGGAGCCTCAGCCGCATGGCGCAAGCCGTCCCCGTCCATCTTCCGCCGAAGCTACGCC
GTTGCCTCGGCCGGAGCTCCGCGCTTCCAGGTCTTCAACCGGCGCACCAAGTGGTTGCACAAGGAGCGGGCCGCC
TCGAGACCCGATGAGAGCCGTCAGGCCGACTATCTAAAGGATGAGGTCGCCGCGAGGTTGACTGACAGGTTGCTT
GATATCAAGCGTCATTTTCCCCGTGTGCTCGACCTGGGAGCGAACTCGTGCAACATCGCCCGAGCCTTGGTCAAG
ACCACGTCAGATGCGTCGAAGCCTGATTTGCCGCCGCCGTCTTCGAGGATAGGGGAGCTCGTGGCCGTTGACTCG
TCCGAGACTCTCCTATATCGCGACGCCCACGACGAATTCAACACCAAGCTTAACATCACTCGACGGGTGTTGGAA
GACGAAGAGAGCATACCGTTCGAACCCCAGTCGTTTGATCTGGTCTTGAGTTCGCTCAGCCTGCACTGGATCAAC
GATCTGCCCGGCATCCTGACGCAGATCAACAACGTTCTCAAGCCCGACTGCCCTTTTGTTGGTGCCATTCTCGGC
GGCGATACGTTGTTCGAGCTGCGGACCTCCCTCCAACTGGCCGAGCAGGAACGTATGGGCGGAATGTCGCCTCAT
GTCTCCCCTCTGGCCGACGTGCGCGACGTTGGCGGCCTCTTACAAAAGGCCGGATTCAAGATGTTGACGGTCGAT
GTTGACGACATCATCGTCGACTACCCAGATACCTTTGCTCTGATGCAGGATCTGCAAGCCATGGCCGAGAATAAT
GCCGTCCTGGGAAGGGAAATGGGGCCGATTCGCAGAGACGTCCTCTTGGCCAATGAGGCCATCTACAGGTCGCTT
CATGGCAACGCCGACGGATCTATTCCAGCCACTTTTCGCATCATATACATGATTGGCTGGCGTGAAGACGCCAAC
CAGCCGAAGCCGTTGCCAAGGGGCAGCGCCGAAGTGAACCTGAAAGATGTATTGGAAAAGTGA
Gene >Ophun1|3229
ATGTCAGTGCGTTGCCTCGGAGCCTCAGCCGCATGGCGCAAGCCGTCCCCGTCCATCTTCCGCCGAAGCTACGCC
GTTGCCTCGGCCGGAGCTCCGCGCTTCCAGGTCTTCAACCGGCGCACCAAGTGGTTGCACAAGGAGCGGGCCGCC
TCGAGACCCGATGAGAGCCGTCAGGCCGACTATCTAAAGGATGAGGTCGCCGCGAGGTTGACTGACAGGTTGCTT
GTGTGTTGCTCCGTTCCTGACATCACGATGAGGGCGTCTCTGACACGCTGCGCTGCAGGATATCAAGCGTCATTT
TCCCCGTGTGCTCGACCTGGGAGCGAACTCGTGCAACATCGCCCGAGCCTTGGTCAAGACCACGTCAGATGCGTC
GAAGCCTGATTTGCCGCCGCCGTCTTCGAGGATAGGGGAGCTCGTGGCCGTTGACTCGTCCGAGACTCTCCTATA
TCGCGACGCCCACGACGAATTCAACACCAAGCTTAACATCACTCGACGGGTGTTGGAAGACGAAGAGAGCATACC
GTTCGAACCCCAGTCGTTTGATCTGGTCTTGAGTTCGCTCAGCCTGCACTGGATCAACGATCTGCCCGGCATCCT
GACGCAGATCAACAACGTTCTCAAGCCCGACTGCCCTTTTGTTGGTGCCATTCTCGGCGGCGATACGTTGTTCGA
GCTGCGGACCTCCCTCCAACTGGCCGAGCAGGAACGTATGGGCGGAATGTCGCCTCATGTCTCCCCTCTGGCCGA
CGTGCGCGACGTTGGCGGCCTCTTACAAAAGGCCGGATTCAAGATGTTGACGGTCGATGTTGACGACATCATCGT
CGACTACCCAGATACCTTTGCTCTGATGCAGGATCTGCAAGCCATGGCCGAGAATAATGCCGTCCTGGGAAGGGA
AATGGGGCCGATTCGCAGAGACGTCCTCTTGGCCAATGAGGCCATCTACAGGTCGCTTCATGGCAACGCCGACGG
ATCTATTCCAGCCACTTTTCGCATCATATACATGATTGGCTGGCGTGAAGACGCCAACCAGCCGAAGCCGTTGCC
AAGGGGCAGCGCCGAAGTGAACCTGAAAGATGTATTGGAAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail