© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|3222 |
| Gene name | |
| Location | Contig_287:6310..7884 |
| Strand | + |
| Gene length (bp) | 1574 |
| Transcript length (bp) | 1518 |
| Coding sequence length (bp) | 1518 |
| Protein length (aa) | 506 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF03719 | Ribosomal_S5_C | Ribosomal protein S5, C-terminal domain | 7.3E-19 | 419 | 487 |
| PF00333 | Ribosomal_S5 | Ribosomal protein S5, N-terminal domain | 3.6E-17 | 342 | 405 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P33759|RT05_YEAST | 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 | 267 | 500 | 7.0E-36 |
| sp|Q10234|RT05_SCHPO | Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 | 316 | 500 | 8.0E-33 |
| sp|Q99N87|RT05_MOUSE | 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 | 349 | 497 | 1.0E-17 |
| sp|Q5REJ1|RT05_PONAB | 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 | 347 | 497 | 6.0E-17 |
| sp|P82675|RT05_HUMAN | 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 | 347 | 497 | 1.0E-15 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P33759|RT05_YEAST | 37S ribosomal protein S5, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS5 PE=1 SV=1 | 267 | 500 | 7.0E-36 |
| sp|Q10234|RT05_SCHPO | Probable 37S ribosomal protein S5, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp5 PE=1 SV=1 | 316 | 500 | 8.0E-33 |
| sp|Q99N87|RT05_MOUSE | 28S ribosomal protein S5, mitochondrial OS=Mus musculus GN=Mrps5 PE=1 SV=1 | 349 | 497 | 1.0E-17 |
| sp|Q5REJ1|RT05_PONAB | 28S ribosomal protein S5, mitochondrial OS=Pongo abelii GN=MRPS5 PE=2 SV=1 | 347 | 497 | 6.0E-17 |
| sp|P82675|RT05_HUMAN | 28S ribosomal protein S5, mitochondrial OS=Homo sapiens GN=MRPS5 PE=1 SV=2 | 347 | 497 | 1.0E-15 |
| sp|P57574|RS5_BUCAI | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpsE PE=3 SV=1 | 344 | 495 | 8.0E-14 |
| sp|Q2KID9|RT05_BOVIN | 28S ribosomal protein S5, mitochondrial OS=Bos taurus GN=MRPS5 PE=1 SV=1 | 347 | 497 | 8.0E-14 |
| sp|Q8K966|RS5_BUCAP | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpsE PE=3 SV=1 | 344 | 495 | 3.0E-12 |
| sp|A1TJT4|RS5_ACIAC | 30S ribosomal protein S5 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsE PE=3 SV=1 | 344 | 495 | 6.0E-12 |
| sp|Q493J1|RS5_BLOPB | 30S ribosomal protein S5 OS=Blochmannia pennsylvanicus (strain BPEN) GN=rpsE PE=3 SV=1 | 344 | 499 | 7.0E-12 |
| sp|Q6CZY7|RS5_PECAS | 30S ribosomal protein S5 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpsE PE=3 SV=1 | 336 | 495 | 1.0E-11 |
| sp|B7VLE0|RS5_VIBTL | 30S ribosomal protein S5 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsE PE=3 SV=1 | 336 | 489 | 1.0E-11 |
| sp|A1W325|RS5_ACISJ | 30S ribosomal protein S5 OS=Acidovorax sp. (strain JS42) GN=rpsE PE=3 SV=1 | 337 | 495 | 2.0E-11 |
| sp|B9MBV4|RS5_ACIET | 30S ribosomal protein S5 OS=Acidovorax ebreus (strain TPSY) GN=rpsE PE=3 SV=1 | 337 | 495 | 2.0E-11 |
| sp|Q7VKF0|RS5_HAEDU | 30S ribosomal protein S5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-11 |
| sp|A8Y3Q1|RT05_CAEBR | Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis briggsae GN=mrps-5 PE=3 SV=3 | 330 | 495 | 3.0E-11 |
| sp|Q93425|RT05_CAEEL | Putative 28S ribosomal protein S5, mitochondrial OS=Caenorhabditis elegans GN=mrps-5 PE=3 SV=3 | 330 | 495 | 3.0E-11 |
| sp|Q32B48|RS5_SHIDS | 30S ribosomal protein S5 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsE PE=3 SV=1 | 336 | 495 | 3.0E-11 |
| sp|Q1LTC1|RS5_BAUCH | 30S ribosomal protein S5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsE PE=3 SV=1 | 336 | 495 | 3.0E-11 |
| sp|Q7MPH1|RS5_VIBVY | 30S ribosomal protein S5 OS=Vibrio vulnificus (strain YJ016) GN=rpsE PE=3 SV=1 | 336 | 489 | 4.0E-11 |
| sp|Q8DE57|RS5_VIBVU | 30S ribosomal protein S5 OS=Vibrio vulnificus (strain CMCP6) GN=rpsE PE=3 SV=1 | 336 | 489 | 4.0E-11 |
| sp|Q3YWV6|RS5_SHISS | 30S ribosomal protein S5 OS=Shigella sonnei (strain Ss046) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|P0A7W6|RS5_SHIFL | 30S ribosomal protein S5 OS=Shigella flexneri GN=rpsE PE=3 SV=2 | 336 | 495 | 5.0E-11 |
| sp|Q0SZZ9|RS5_SHIF8 | 30S ribosomal protein S5 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|Q31VX3|RS5_SHIBS | 30S ribosomal protein S5 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|P0A7W4|RS5_SALTY | 30S ribosomal protein S5 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsE PE=1 SV=2 | 336 | 495 | 5.0E-11 |
| sp|P0A7W5|RS5_SALTI | 30S ribosomal protein S5 OS=Salmonella typhi GN=rpsE PE=3 SV=2 | 336 | 495 | 5.0E-11 |
| sp|A9MSY1|RS5_SALPB | 30S ribosomal protein S5 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|Q5PK01|RS5_SALPA | 30S ribosomal protein S5 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|Q57J49|RS5_SALCH | 30S ribosomal protein S5 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|A9MN66|RS5_SALAR | 30S ribosomal protein S5 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|Q1R627|RS5_ECOUT | 30S ribosomal protein S5 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|P0A7W1|RS5_ECOLI | 30S ribosomal protein S5 OS=Escherichia coli (strain K12) GN=rpsE PE=1 SV=2 | 336 | 495 | 5.0E-11 |
| sp|B1IPZ6|RS5_ECOLC | 30S ribosomal protein S5 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|P0A7W2|RS5_ECOL6 | 30S ribosomal protein S5 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsE PE=3 SV=2 | 336 | 495 | 5.0E-11 |
| sp|Q0TCF8|RS5_ECOL5 | 30S ribosomal protein S5 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|A1AGJ2|RS5_ECOK1 | 30S ribosomal protein S5 OS=Escherichia coli O1:K1 / APEC GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|A8A5A8|RS5_ECOHS | 30S ribosomal protein S5 OS=Escherichia coli O9:H4 (strain HS) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|P0A7W3|RS5_ECO57 | 30S ribosomal protein S5 OS=Escherichia coli O157:H7 GN=rpsE PE=3 SV=2 | 336 | 495 | 5.0E-11 |
| sp|A7ZSJ2|RS5_ECO24 | 30S ribosomal protein S5 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|A8AQJ8|RS5_CITK8 | 30S ribosomal protein S5 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-11 |
| sp|A9KWB9|RS5_SHEB9 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS195) GN=rpsE PE=3 SV=1 | 333 | 496 | 5.0E-11 |
| sp|A6WHU5|RS5_SHEB8 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS185) GN=rpsE PE=3 SV=1 | 333 | 496 | 5.0E-11 |
| sp|A3DA55|RS5_SHEB5 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsE PE=3 SV=1 | 333 | 496 | 5.0E-11 |
| sp|B8EBI8|RS5_SHEB2 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS223) GN=rpsE PE=3 SV=1 | 333 | 496 | 5.0E-11 |
| sp|A1RED1|RS5_SHESW | 30S ribosomal protein S5 OS=Shewanella sp. (strain W3-18-1) GN=rpsE PE=3 SV=1 | 333 | 496 | 5.0E-11 |
| sp|A4YBW6|RS5_SHEPC | 30S ribosomal protein S5 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpsE PE=3 SV=1 | 333 | 496 | 5.0E-11 |
| sp|Q87SZ6|RS5_VIBPA | 30S ribosomal protein S5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsE PE=3 SV=1 | 336 | 489 | 6.0E-11 |
| sp|A7MWH5|RS5_VIBCB | 30S ribosomal protein S5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsE PE=3 SV=1 | 336 | 489 | 6.0E-11 |
| sp|Q089N7|RS5_SHEFN | 30S ribosomal protein S5 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpsE PE=3 SV=1 | 333 | 496 | 7.0E-11 |
| sp|Q12SU2|RS5_SHEDO | 30S ribosomal protein S5 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpsE PE=3 SV=1 | 333 | 496 | 7.0E-11 |
| sp|Q2NQN9|RS5_SODGM | 30S ribosomal protein S5 OS=Sodalis glossinidius (strain morsitans) GN=rpsE PE=3 SV=1 | 336 | 495 | 7.0E-11 |
| sp|Q0I088|RS5_SHESR | 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-7) GN=rpsE PE=3 SV=1 | 333 | 496 | 7.0E-11 |
| sp|Q0HNS0|RS5_SHESM | 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-4) GN=rpsE PE=3 SV=1 | 333 | 496 | 7.0E-11 |
| sp|A0KRP1|RS5_SHESA | 30S ribosomal protein S5 OS=Shewanella sp. (strain ANA-3) GN=rpsE PE=3 SV=1 | 333 | 496 | 7.0E-11 |
| sp|P59124|RS5_SHEON | 30S ribosomal protein S5 OS=Shewanella oneidensis (strain MR-1) GN=rpsE PE=3 SV=1 | 333 | 496 | 7.0E-11 |
| sp|A7MPG7|RS5_CROS8 | 30S ribosomal protein S5 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpsE PE=3 SV=1 | 336 | 495 | 8.0E-11 |
| sp|A1S235|RS5_SHEAM | 30S ribosomal protein S5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsE PE=3 SV=1 | 336 | 496 | 8.0E-11 |
| sp|Q7VQD1|RS5_BLOFL | 30S ribosomal protein S5 OS=Blochmannia floridanus GN=rpsE PE=3 SV=1 | 337 | 492 | 8.0E-11 |
| sp|A0KF38|RS5_AERHH | 30S ribosomal protein S5 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rpsE PE=3 SV=1 | 337 | 495 | 1.0E-10 |
| sp|C4L7U7|RS5_TOLAT | 30S ribosomal protein S5 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rpsE PE=3 SV=1 | 337 | 495 | 1.0E-10 |
| sp|Q83EQ9|RS5_COXBU | 30S ribosomal protein S5 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsE PE=3 SV=1 | 344 | 495 | 1.0E-10 |
| sp|Q7MYG8|RS5_PHOLL | 30S ribosomal protein S5 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpsE PE=3 SV=1 | 336 | 495 | 1.0E-10 |
| sp|Q0ABF8|RS5_ALKEH | 30S ribosomal protein S5 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsE PE=3 SV=1 | 334 | 495 | 2.0E-10 |
| sp|P44374|RS5_HAEIN | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-10 |
| sp|A5UHU8|RS5_HAEIG | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittGG) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-10 |
| sp|A5UDT0|RS5_HAEIE | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittEE) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-10 |
| sp|Q4QMA4|RS5_HAEI8 | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-10 |
| sp|A4WFB1|RS5_ENT38 | 30S ribosomal protein S5 OS=Enterobacter sp. (strain 638) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-10 |
| sp|A4SSY9|RS5_AERS4 | 30S ribosomal protein S5 OS=Aeromonas salmonicida (strain A449) GN=rpsE PE=3 SV=1 | 337 | 495 | 2.0E-10 |
| sp|Q65QX2|RS5_MANSM | 30S ribosomal protein S5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-10 |
| sp|C3LRP1|RS5_VIBCM | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsE PE=3 SV=1 | 336 | 489 | 2.0E-10 |
| sp|Q9KP01|RS5_VIBCH | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsE PE=3 SV=1 | 336 | 489 | 2.0E-10 |
| sp|A5F563|RS5_VIBC3 | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsE PE=3 SV=1 | 336 | 489 | 2.0E-10 |
| sp|A3N374|RS5_ACTP2 | 30S ribosomal protein S5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsE PE=3 SV=1 | 336 | 495 | 4.0E-10 |
| sp|A1JS11|RS5_YERE8 | 30S ribosomal protein S5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsE PE=3 SV=1 | 336 | 495 | 4.0E-10 |
| sp|Q31IW5|RS5_THICR | 30S ribosomal protein S5 OS=Thiomicrospira crunogena (strain XCL-2) GN=rpsE PE=3 SV=1 | 339 | 492 | 4.0E-10 |
| sp|Q15X56|RS5_PSEA6 | 30S ribosomal protein S5 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsE PE=3 SV=1 | 335 | 495 | 4.0E-10 |
| sp|B6EPU2|RS5_ALISL | 30S ribosomal protein S5 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsE PE=3 SV=1 | 336 | 489 | 4.0E-10 |
| sp|A1T0C5|RS5_PSYIN | 30S ribosomal protein S5 OS=Psychromonas ingrahamii (strain 37) GN=rpsE PE=3 SV=1 | 337 | 489 | 4.0E-10 |
| sp|Q21QP0|RS5_RHOFT | 30S ribosomal protein S5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsE PE=3 SV=1 | 329 | 492 | 5.0E-10 |
| sp|Q664T8|RS5_YERPS | 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-10 |
| sp|A4TH09|RS5_YERPP | 30S ribosomal protein S5 OS=Yersinia pestis (strain Pestoides F) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-10 |
| sp|Q1CCW1|RS5_YERPN | 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-10 |
| sp|Q8ZJ95|RS5_YERPE | 30S ribosomal protein S5 OS=Yersinia pestis GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-10 |
| sp|Q1C2W4|RS5_YERPA | 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-10 |
| sp|A7FNL7|RS5_YERP3 | 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-10 |
| sp|A1WK99|RS5_VEREI | 30S ribosomal protein S5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsE PE=3 SV=1 | 339 | 495 | 5.0E-10 |
| sp|A6TEV5|RS5_KLEP7 | 30S ribosomal protein S5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-10 |
| sp|A1KRJ0|RS5_NEIMF | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpsE PE=3 SV=1 | 339 | 501 | 6.0E-10 |
| sp|P66577|RS5_NEIMB | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpsE PE=3 SV=1 | 339 | 501 | 6.0E-10 |
| sp|P66576|RS5_NEIMA | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpsE PE=3 SV=1 | 339 | 501 | 6.0E-10 |
| sp|A9M3U9|RS5_NEIM0 | 30S ribosomal protein S5 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpsE PE=3 SV=1 | 339 | 501 | 6.0E-10 |
| sp|Q5F5U4|RS5_NEIG1 | 30S ribosomal protein S5 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpsE PE=3 SV=1 | 339 | 501 | 6.0E-10 |
| sp|B5FG26|RS5_VIBFM | 30S ribosomal protein S5 OS=Vibrio fischeri (strain MJ11) GN=rpsE PE=3 SV=1 | 336 | 489 | 6.0E-10 |
| sp|Q5E897|RS5_VIBF1 | 30S ribosomal protein S5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsE PE=3 SV=1 | 336 | 489 | 6.0E-10 |
| sp|Q9CL47|RS5_PASMU | 30S ribosomal protein S5 OS=Pasteurella multocida (strain Pm70) GN=rpsE PE=3 SV=1 | 336 | 495 | 7.0E-10 |
| sp|A3Q999|RS5_SHELP | 30S ribosomal protein S5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsE PE=3 SV=1 | 337 | 496 | 7.0E-10 |
| sp|Q9PE59|RS5_XYLFA | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain 9a5c) GN=rpsE PE=3 SV=1 | 344 | 501 | 1.0E-09 |
| sp|Q5QXW2|RS5_IDILO | 30S ribosomal protein S5 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpsE PE=3 SV=1 | 337 | 495 | 1.0E-09 |
| sp|Q2RQX7|RS5_RHORT | 30S ribosomal protein S5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsE PE=3 SV=1 | 351 | 495 | 1.0E-09 |
| sp|B0UX31|RS5_HISS2 | 30S ribosomal protein S5 OS=Histophilus somni (strain 2336) GN=rpsE PE=3 SV=1 | 336 | 492 | 1.0E-09 |
| sp|Q0I145|RS5_HAES1 | 30S ribosomal protein S5 OS=Haemophilus somnus (strain 129Pt) GN=rpsE PE=3 SV=1 | 336 | 492 | 1.0E-09 |
| sp|A7HWS8|RS5_PARL1 | 30S ribosomal protein S5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-09 |
| sp|Q4FLN5|RS5_PELUB | 30S ribosomal protein S5 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsE PE=3 SV=1 | 364 | 495 | 2.0E-09 |
| sp|Q2N9C8|RS5_ERYLH | 30S ribosomal protein S5 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsE PE=3 SV=1 | 338 | 495 | 2.0E-09 |
| sp|A8GKI0|RS5_SERP5 | 30S ribosomal protein S5 OS=Serratia proteamaculans (strain 568) GN=rpsE PE=3 SV=1 | 336 | 495 | 2.0E-09 |
| sp|B0U5L6|RS5_XYLFM | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M12) GN=rpsE PE=3 SV=1 | 344 | 494 | 3.0E-09 |
| sp|A9BRW8|RS5_DELAS | 30S ribosomal protein S5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-09 |
| sp|A6VLK5|RS5_ACTSZ | 30S ribosomal protein S5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsE PE=3 SV=1 | 336 | 495 | 3.0E-09 |
| sp|Q8D1Z5|RS5_WIGBR | 30S ribosomal protein S5 OS=Wigglesworthia glossinidia brevipalpis GN=rpsE PE=3 SV=1 | 336 | 495 | 3.0E-09 |
| sp|A5FZU8|RS5_ACICJ | 30S ribosomal protein S5 OS=Acidiphilium cryptum (strain JF-5) GN=rpsE PE=3 SV=1 | 351 | 495 | 3.0E-09 |
| sp|Q6LV99|RS5_PHOPR | 30S ribosomal protein S5 OS=Photobacterium profundum GN=rpsE PE=3 SV=1 | 344 | 489 | 4.0E-09 |
| sp|Q5GSW1|RS5_WOLTR | 30S ribosomal protein S5 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rpsE PE=3 SV=1 | 347 | 495 | 4.0E-09 |
| sp|Q12G86|RS5_POLSJ | 30S ribosomal protein S5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsE PE=3 SV=1 | 339 | 495 | 6.0E-09 |
| sp|Q057C1|RS5_BUCCC | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsE PE=3 SV=1 | 351 | 490 | 6.0E-09 |
| sp|Q3YRM6|RS5_EHRCJ | 30S ribosomal protein S5 OS=Ehrlichia canis (strain Jake) GN=rpsE PE=3 SV=1 | 347 | 495 | 6.0E-09 |
| sp|Q73HA3|RS5_WOLPM | 30S ribosomal protein S5 OS=Wolbachia pipientis wMel GN=rpsE PE=3 SV=1 | 347 | 495 | 7.0E-09 |
| sp|Q488Z6|RS5_COLP3 | 30S ribosomal protein S5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsE PE=3 SV=1 | 344 | 492 | 7.0E-09 |
| sp|Q89A82|RS5_BUCBP | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsE PE=3 SV=2 | 344 | 490 | 7.0E-09 |
| sp|Q3IJK2|RS5_PSEHT | 30S ribosomal protein S5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsE PE=3 SV=1 | 336 | 495 | 7.0E-09 |
| sp|Q5NQ48|RS5_ZYMMO | 30S ribosomal protein S5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsE PE=3 SV=1 | 339 | 495 | 8.0E-09 |
| sp|Q87E65|RS5_XYLFT | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpsE PE=3 SV=1 | 344 | 494 | 8.0E-09 |
| sp|B2I8I6|RS5_XYLF2 | 30S ribosomal protein S5 OS=Xylella fastidiosa (strain M23) GN=rpsE PE=3 SV=1 | 344 | 494 | 8.0E-09 |
| sp|Q2GH39|RS5_EHRCR | 30S ribosomal protein S5 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpsE PE=3 SV=1 | 347 | 495 | 9.0E-09 |
| sp|A4IZR7|RS5_FRATW | 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsE PE=3 SV=1 | 335 | 496 | 1.0E-08 |
| sp|Q5NHV1|RS5_FRATT | 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsE PE=3 SV=1 | 335 | 496 | 1.0E-08 |
| sp|Q0BNR0|RS5_FRATO | 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsE PE=3 SV=1 | 335 | 496 | 1.0E-08 |
| sp|A0Q4K0|RS5_FRATN | 30S ribosomal protein S5 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsE PE=3 SV=1 | 335 | 496 | 1.0E-08 |
| sp|A7N9U2|RS5_FRATF | 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsE PE=3 SV=1 | 335 | 496 | 1.0E-08 |
| sp|Q14JA3|RS5_FRAT1 | 30S ribosomal protein S5 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsE PE=3 SV=1 | 335 | 496 | 1.0E-08 |
| sp|Q2A5F3|RS5_FRATH | 30S ribosomal protein S5 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsE PE=3 SV=1 | 335 | 496 | 1.0E-08 |
| sp|A1VJ32|RS5_POLNA | 30S ribosomal protein S5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-08 |
| sp|A1AVL7|RS5_RUTMC | 30S ribosomal protein S5 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsE PE=3 SV=1 | 349 | 492 | 1.0E-08 |
| sp|Q9Z7S3|RS5_CHLPN | 30S ribosomal protein S5 OS=Chlamydia pneumoniae GN=rpsE PE=3 SV=1 | 344 | 484 | 2.0E-08 |
| sp|B2T734|RS5_BURPP | 30S ribosomal protein S5 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsE PE=3 SV=1 | 339 | 495 | 2.0E-08 |
| sp|Q13TI7|RS5_BURXL | 30S ribosomal protein S5 OS=Burkholderia xenovorans (strain LB400) GN=rpsE PE=3 SV=1 | 339 | 495 | 2.0E-08 |
| sp|A4JAQ7|RS5_BURVG | 30S ribosomal protein S5 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-08 |
| sp|Q0BJ29|RS5_BURCM | 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-08 |
| sp|A0K3P2|RS5_BURCH | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-08 |
| sp|B1JU39|RS5_BURCC | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-08 |
| sp|Q1BRW5|RS5_BURCA | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-08 |
| sp|B1YRP6|RS5_BURA4 | 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-08 |
| sp|Q2GL42|RS5_ANAPZ | 30S ribosomal protein S5 OS=Anaplasma phagocytophilum (strain HZ) GN=rpsE PE=3 SV=1 | 362 | 495 | 3.0E-08 |
| sp|B0V6W2|RS5_ACIBY | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AYE) GN=rpsE PE=3 SV=1 | 335 | 496 | 3.0E-08 |
| sp|B0VQT5|RS5_ACIBS | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain SDF) GN=rpsE PE=3 SV=1 | 335 | 496 | 3.0E-08 |
| sp|B2HZ91|RS5_ACIBC | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ACICU) GN=rpsE PE=3 SV=1 | 335 | 496 | 3.0E-08 |
| sp|B7IA22|RS5_ACIB5 | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB0057) GN=rpsE PE=3 SV=1 | 335 | 496 | 3.0E-08 |
| sp|B7GW19|RS5_ACIB3 | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpsE PE=3 SV=1 | 335 | 496 | 3.0E-08 |
| sp|B2JI48|RS5_BURP8 | 30S ribosomal protein S5 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-08 |
| sp|A1RWR6|RS5_THEPD | 30S ribosomal protein S5 OS=Thermofilum pendens (strain Hrk 5) GN=rps5 PE=3 SV=1 | 350 | 475 | 4.0E-08 |
| sp|B5ZB57|RS5_UREU1 | 30S ribosomal protein S5 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsE PE=3 SV=1 | 327 | 492 | 4.0E-08 |
| sp|B4RT45|RS5_ALTMD | 30S ribosomal protein S5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsE PE=3 SV=1 | 344 | 489 | 4.0E-08 |
| sp|Q2W2K8|RS5_MAGSA | 30S ribosomal protein S5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsE PE=3 SV=1 | 351 | 495 | 5.0E-08 |
| sp|Q9PQP3|RS5_UREPA | 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsE PE=3 SV=1 | 327 | 495 | 5.0E-08 |
| sp|B1AIN7|RS5_UREP2 | 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsE PE=3 SV=1 | 327 | 495 | 5.0E-08 |
| sp|A2SLE0|RS5_METPP | 30S ribosomal protein S5 OS=Methylibium petroleiphilum (strain PM1) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-08 |
| sp|B5ELZ6|RS5_ACIF5 | 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsE PE=3 SV=1 | 351 | 496 | 6.0E-08 |
| sp|B7J484|RS5_ACIF2 | 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsE PE=3 SV=1 | 351 | 496 | 6.0E-08 |
| sp|Q3J8T1|RS5_NITOC | 30S ribosomal protein S5 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rpsE PE=3 SV=1 | 339 | 495 | 7.0E-08 |
| sp|Q9A8T6|RS5_CAUCR | 30S ribosomal protein S5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsE PE=3 SV=1 | 351 | 495 | 7.0E-08 |
| sp|B8H4F1|RS5_CAUCN | 30S ribosomal protein S5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsE PE=3 SV=1 | 351 | 495 | 7.0E-08 |
| sp|Q28UT7|RS5_JANSC | 30S ribosomal protein S5 OS=Jannaschia sp. (strain CCS1) GN=rpsE PE=3 SV=1 | 351 | 495 | 7.0E-08 |
| sp|Q8A493|RS5_BACTN | 30S ribosomal protein S5 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsE PE=3 SV=1 | 351 | 501 | 8.0E-08 |
| sp|Q5HAT9|RS5_EHRRW | 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpsE PE=3 SV=1 | 347 | 492 | 8.0E-08 |
| sp|Q5FFR5|RS5_EHRRG | 30S ribosomal protein S5 OS=Ehrlichia ruminantium (strain Gardel) GN=rpsE PE=3 SV=2 | 347 | 492 | 8.0E-08 |
| sp|A6U876|RS5_SINMW | 30S ribosomal protein S5 OS=Sinorhizobium medicae (strain WSM419) GN=rpsE PE=3 SV=1 | 351 | 491 | 8.0E-08 |
| sp|Q92QF3|RS5_RHIME | 30S ribosomal protein S5 OS=Rhizobium meliloti (strain 1021) GN=rpsE PE=3 SV=1 | 351 | 491 | 8.0E-08 |
| sp|A0L5Z0|RS5_MAGMM | 30S ribosomal protein S5 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsE PE=3 SV=1 | 362 | 496 | 9.0E-08 |
| sp|Q47LL0|RS5_THEFY | 30S ribosomal protein S5 OS=Thermobifida fusca (strain YX) GN=rpsE PE=3 SV=1 | 351 | 495 | 9.0E-08 |
| sp|Q2SU44|RS5_BURTA | 30S ribosomal protein S5 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsE PE=3 SV=1 | 339 | 495 | 9.0E-08 |
| sp|B0T2D9|RS5_CAUSK | 30S ribosomal protein S5 OS=Caulobacter sp. (strain K31) GN=rpsE PE=3 SV=1 | 351 | 495 | 1.0E-07 |
| sp|Q5WZJ5|RS5_LEGPL | 30S ribosomal protein S5 OS=Legionella pneumophila (strain Lens) GN=rpsE PE=3 SV=1 | 358 | 495 | 1.0E-07 |
| sp|Q5ZYM6|RS5_LEGPH | 30S ribosomal protein S5 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpsE PE=3 SV=1 | 358 | 495 | 1.0E-07 |
| sp|A5IHP7|RS5_LEGPC | 30S ribosomal protein S5 OS=Legionella pneumophila (strain Corby) GN=rpsE PE=3 SV=1 | 358 | 495 | 1.0E-07 |
| sp|Q5X842|RS5_LEGPA | 30S ribosomal protein S5 OS=Legionella pneumophila (strain Paris) GN=rpsE PE=3 SV=1 | 358 | 495 | 1.0E-07 |
| sp|A8LM74|RS5_DINSH | 30S ribosomal protein S5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsE PE=3 SV=1 | 351 | 497 | 1.0E-07 |
| sp|C5CQ83|RS5_VARPS | 30S ribosomal protein S5 OS=Variovorax paradoxus (strain S110) GN=rpsE PE=3 SV=1 | 339 | 489 | 1.0E-07 |
| sp|A8IAP6|RS5_AZOC5 | 30S ribosomal protein S5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsE PE=3 SV=1 | 351 | 492 | 1.0E-07 |
| sp|Q39KF0|RS5_BURL3 | 30S ribosomal protein S5 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|B4E5D7|RS5_BURCJ | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|B4R8N4|RS5_PHEZH | 30S ribosomal protein S5 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsE PE=3 SV=1 | 351 | 495 | 1.0E-07 |
| sp|A0M581|RS5_GRAFK | 30S ribosomal protein S5 OS=Gramella forsetii (strain KT0803) GN=rpsE PE=3 SV=1 | 351 | 501 | 1.0E-07 |
| sp|A4G9S1|RS5_HERAR | 30S ribosomal protein S5 OS=Herminiimonas arsenicoxydans GN=rpsE PE=3 SV=1 | 344 | 495 | 1.0E-07 |
| sp|A5CXM1|RS5_VESOH | 30S ribosomal protein S5 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpsE PE=3 SV=1 | 336 | 489 | 1.0E-07 |
| sp|A5V5Y5|RS5_SPHWW | 30S ribosomal protein S5 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpsE PE=3 SV=1 | 336 | 495 | 1.0E-07 |
| sp|Q63Q28|RS5_BURPS | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain K96243) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|A3NEG2|RS5_BURP6 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 668) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|Q3JMT0|RS5_BURP1 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|A3P096|RS5_BURP0 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|A1V886|RS5_BURMS | 30S ribosomal protein S5 OS=Burkholderia mallei (strain SAVP1) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|Q62GM2|RS5_BURMA | 30S ribosomal protein S5 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|A2S7J3|RS5_BURM9 | 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|A3MRX1|RS5_BURM7 | 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|A9ADL0|RS5_BURM1 | 30S ribosomal protein S5 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-07 |
| sp|Q0BYD1|RS5_HYPNA | 30S ribosomal protein S5 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsE PE=3 SV=1 | 341 | 495 | 1.0E-07 |
| sp|Q0ANR7|RS5_MARMM | 30S ribosomal protein S5 OS=Maricaulis maris (strain MCS10) GN=rpsE PE=3 SV=1 | 339 | 495 | 2.0E-07 |
| sp|Q7MTN0|RS5_PORGI | 30S ribosomal protein S5 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsE PE=3 SV=1 | 351 | 501 | 2.0E-07 |
| sp|Q605C9|RS5_METCA | 30S ribosomal protein S5 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpsE PE=3 SV=1 | 339 | 489 | 2.0E-07 |
| sp|Q1R0F8|RS5_CHRSD | 30S ribosomal protein S5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsE PE=3 SV=1 | 351 | 489 | 2.0E-07 |
| sp|Q47J86|RS5_DECAR | 30S ribosomal protein S5 OS=Dechloromonas aromatica (strain RCB) GN=rpsE PE=3 SV=1 | 344 | 489 | 2.0E-07 |
| sp|Q5L704|RS5_CHLAB | 30S ribosomal protein S5 OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpsE PE=3 SV=1 | 344 | 477 | 2.0E-07 |
| sp|Q6F7S9|RS5_ACIAD | 30S ribosomal protein S5 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpsE PE=3 SV=1 | 335 | 489 | 3.0E-07 |
| sp|A6KYH8|RS5_BACV8 | 30S ribosomal protein S5 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsE PE=3 SV=1 | 351 | 501 | 3.0E-07 |
| sp|Q2L266|RS5_BORA1 | 30S ribosomal protein S5 OS=Bordetella avium (strain 197N) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-07 |
| sp|Q68W95|RS5_RICTY | 30S ribosomal protein S5 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpsE PE=3 SV=1 | 362 | 495 | 4.0E-07 |
| sp|A3M967|RS5_ACIBT | 30S ribosomal protein S5 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpsE PE=3 SV=2 | 339 | 496 | 4.0E-07 |
| sp|Q5PA75|RS5_ANAMM | 30S ribosomal protein S5 OS=Anaplasma marginale (strain St. Maries) GN=rpsE PE=3 SV=1 | 358 | 495 | 4.0E-07 |
| sp|B9KJ53|RS5_ANAMF | 30S ribosomal protein S5 OS=Anaplasma marginale (strain Florida) GN=rpsE PE=3 SV=1 | 358 | 495 | 4.0E-07 |
| sp|Q64NM5|RS5_BACFR | 30S ribosomal protein S5 OS=Bacteroides fragilis (strain YCH46) GN=rpsE PE=3 SV=1 | 351 | 501 | 4.0E-07 |
| sp|Q5L8C6|RS5_BACFN | 30S ribosomal protein S5 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsE PE=3 SV=1 | 351 | 501 | 4.0E-07 |
| sp|A4VHP7|RS5_PSEU5 | 30S ribosomal protein S5 OS=Pseudomonas stutzeri (strain A1501) GN=rpsE PE=3 SV=1 | 351 | 495 | 4.0E-07 |
| sp|A1WVA5|RS5_HALHL | 30S ribosomal protein S5 OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rpsE PE=3 SV=1 | 339 | 495 | 5.0E-07 |
| sp|Q16AC7|RS5_ROSDO | 30S ribosomal protein S5 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsE PE=3 SV=1 | 351 | 495 | 5.0E-07 |
| sp|Q1QDG9|RS5_PSYCK | 30S ribosomal protein S5 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsE PE=3 SV=1 | 336 | 492 | 5.0E-07 |
| sp|Q4FUD9|RS5_PSYA2 | 30S ribosomal protein S5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsE PE=3 SV=1 | 336 | 492 | 5.0E-07 |
| sp|Q8EUD0|RS5_MYCPE | 30S ribosomal protein S5 OS=Mycoplasma penetrans (strain HF-2) GN=rpsE PE=3 SV=1 | 336 | 495 | 5.0E-07 |
| sp|Q252W9|RS5_CHLFF | 30S ribosomal protein S5 OS=Chlamydophila felis (strain Fe/C-56) GN=rpsE PE=3 SV=1 | 344 | 477 | 5.0E-07 |
| sp|Q0VSI6|RS5_ALCBS | 30S ribosomal protein S5 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpsE PE=3 SV=1 | 339 | 495 | 6.0E-07 |
| sp|A1A086|RS5_BIFAA | 30S ribosomal protein S5 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpsE PE=3 SV=1 | 351 | 495 | 7.0E-07 |
| sp|Q8RIH3|RS5_FUSNN | 30S ribosomal protein S5 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsE PE=3 SV=1 | 351 | 495 | 7.0E-07 |
| sp|P46183|RS5_BUCAK | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rpsE PE=3 SV=2 | 336 | 495 | 8.0E-07 |
| sp|Q1GK12|RS5_RUEST | 30S ribosomal protein S5 OS=Ruegeria sp. (strain TM1040) GN=rpsE PE=3 SV=1 | 351 | 495 | 8.0E-07 |
| sp|P0A4C8|RS5_CHLTR | 30S ribosomal protein S5 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsE PE=3 SV=1 | 358 | 476 | 9.0E-07 |
| sp|Q3KLI5|RS5_CHLTA | 30S ribosomal protein S5 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsE PE=3 SV=1 | 358 | 476 | 9.0E-07 |
| sp|P0A4C9|RS5_CHLMU | 30S ribosomal protein S5 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsE PE=3 SV=1 | 358 | 476 | 9.0E-07 |
| sp|Q5LW41|RS5_RUEPO | 30S ribosomal protein S5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsE PE=3 SV=1 | 351 | 495 | 9.0E-07 |
| sp|A0LIK7|RS5_SYNFM | 30S ribosomal protein S5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsE PE=3 SV=1 | 351 | 496 | 9.0E-07 |
| sp|A4YSK9|RS5_BRASO | 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsE PE=3 SV=2 | 351 | 502 | 9.0E-07 |
| sp|A5ELL0|RS5_BRASB | 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsE PE=3 SV=1 | 351 | 502 | 9.0E-07 |
| sp|B8G6Q8|RS5_CHLAD | 30S ribosomal protein S5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsE PE=3 SV=1 | 351 | 475 | 1.0E-06 |
| sp|C3MAZ7|RS5_RHISN | 30S ribosomal protein S5 OS=Rhizobium sp. (strain NGR234) GN=rpsE PE=3 SV=1 | 351 | 503 | 1.0E-06 |
| sp|Q2G8W3|RS5_NOVAD | 30S ribosomal protein S5 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpsE PE=3 SV=1 | 339 | 495 | 1.0E-06 |
| sp|Q6AD11|RS5_LEIXX | 30S ribosomal protein S5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsE PE=3 SV=1 | 351 | 489 | 1.0E-06 |
| sp|P47414|RS5_MYCGE | 30S ribosomal protein S5 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsE PE=3 SV=1 | 351 | 495 | 1.0E-06 |
| sp|A6LEH4|RS5_PARD8 | 30S ribosomal protein S5 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsE PE=3 SV=1 | 351 | 501 | 1.0E-06 |
| sp|Q07KN5|RS5_RHOP5 | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsE PE=3 SV=1 | 351 | 502 | 1.0E-06 |
| sp|B9LJE9|RS5_CHLSY | 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsE PE=3 SV=1 | 351 | 475 | 1.0E-06 |
| sp|A9WH83|RS5_CHLAA | 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsE PE=3 SV=1 | 351 | 475 | 1.0E-06 |
| sp|Q2S929|RS5_HAHCH | 30S ribosomal protein S5 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsE PE=3 SV=1 | 351 | 495 | 1.0E-06 |
| sp|Q4ZMR1|RS5_PSEU2 | 30S ribosomal protein S5 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|Q889V4|RS5_PSESM | 30S ribosomal protein S5 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|A7IPQ3|RS5_XANP2 | 30S ribosomal protein S5 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsE PE=3 SV=1 | 351 | 492 | 2.0E-06 |
| sp|Q92GY3|RS5_RICCN | 30S ribosomal protein S5 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpsE PE=3 SV=1 | 358 | 495 | 2.0E-06 |
| sp|Q211G5|RS5_RHOPB | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsE PE=3 SV=1 | 351 | 502 | 2.0E-06 |
| sp|C3PP90|RS5_RICAE | 30S ribosomal protein S5 OS=Rickettsia africae (strain ESF-5) GN=rpsE PE=3 SV=1 | 358 | 495 | 2.0E-06 |
| sp|A8F2D0|RS5_RICM5 | 30S ribosomal protein S5 OS=Rickettsia massiliae (strain Mtu5) GN=rpsE PE=3 SV=2 | 362 | 495 | 2.0E-06 |
| sp|Q1IFU9|RS5_PSEE4 | 30S ribosomal protein S5 OS=Pseudomonas entomophila (strain L48) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|Q6A6P3|RS5_PROAC | 30S ribosomal protein S5 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|A8GT52|RS5_RICRS | 30S ribosomal protein S5 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpsE PE=3 SV=1 | 358 | 495 | 2.0E-06 |
| sp|B0BUP3|RS5_RICRO | 30S ribosomal protein S5 OS=Rickettsia rickettsii (strain Iowa) GN=rpsE PE=3 SV=1 | 358 | 495 | 2.0E-06 |
| sp|B4SKY0|RS5_STRM5 | 30S ribosomal protein S5 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpsE PE=3 SV=1 | 339 | 492 | 2.0E-06 |
| sp|Q8UE35|RS5_AGRFC | 30S ribosomal protein S5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsE PE=3 SV=1 | 351 | 491 | 2.0E-06 |
| sp|B1JAJ5|RS5_PSEPW | 30S ribosomal protein S5 OS=Pseudomonas putida (strain W619) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|Q88QL8|RS5_PSEPK | 30S ribosomal protein S5 OS=Pseudomonas putida (strain KT2440) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|B0KK84|RS5_PSEPG | 30S ribosomal protein S5 OS=Pseudomonas putida (strain GB-1) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|A5VXR4|RS5_PSEP1 | 30S ribosomal protein S5 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsE PE=3 SV=1 | 351 | 495 | 2.0E-06 |
| sp|A1TYL4|RS5_MARHV | 30S ribosomal protein S5 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpsE PE=3 SV=1 | 351 | 495 | 3.0E-06 |
| sp|B2FQK1|RS5_STRMK | 30S ribosomal protein S5 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpsE PE=3 SV=1 | 339 | 492 | 3.0E-06 |
| sp|A6T3I7|RS5_JANMA | 30S ribosomal protein S5 OS=Janthinobacterium sp. (strain Marseille) GN=rpsE PE=3 SV=1 | 344 | 490 | 3.0E-06 |
| sp|Q824N5|RS5_CHLCV | 30S ribosomal protein S5 OS=Chlamydophila caviae (strain GPIC) GN=rpsE PE=3 SV=1 | 344 | 477 | 3.0E-06 |
| sp|Q4UMR2|RS5_RICFE | 30S ribosomal protein S5 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpsE PE=3 SV=1 | 362 | 495 | 3.0E-06 |
| sp|A4XZ73|RS5_PSEMY | 30S ribosomal protein S5 OS=Pseudomonas mendocina (strain ymp) GN=rpsE PE=3 SV=1 | 351 | 495 | 3.0E-06 |
| sp|Q48D53|RS5_PSE14 | 30S ribosomal protein S5 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsE PE=3 SV=1 | 351 | 495 | 3.0E-06 |
| sp|Q89JA1|RS5_BRADU | 30S ribosomal protein S5 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsE PE=3 SV=1 | 351 | 502 | 3.0E-06 |
| sp|A8GPD3|RS5_RICAH | 30S ribosomal protein S5 OS=Rickettsia akari (strain Hartford) GN=rpsE PE=3 SV=1 | 362 | 495 | 3.0E-06 |
| sp|Q0BUN3|RS5_GRABC | 30S ribosomal protein S5 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsE PE=3 SV=1 | 351 | 495 | 3.0E-06 |
| sp|B7GNC3|RS5_BIFLS | 30S ribosomal protein S5 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-06 |
| sp|B3DQD1|RS5_BIFLD | 30S ribosomal protein S5 OS=Bifidobacterium longum (strain DJO10A) GN=rpsE PE=3 SV=1 | 339 | 495 | 3.0E-06 |
| sp|Q46WG1|RS5_CUPPJ | 30S ribosomal protein S5 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsE PE=3 SV=1 | 335 | 495 | 3.0E-06 |
| sp|C4K2G2|RS5_RICPU | 30S ribosomal protein S5 OS=Rickettsia peacockii (strain Rustic) GN=rpsE PE=3 SV=1 | 358 | 495 | 3.0E-06 |
| sp|Q9ZCS2|RS5_RICPR | 30S ribosomal protein S5 OS=Rickettsia prowazekii (strain Madrid E) GN=rpsE PE=3 SV=1 | 362 | 495 | 4.0E-06 |
| sp|A6X0D5|RS5_OCHA4 | 30S ribosomal protein S5 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsE PE=3 SV=1 | 351 | 491 | 4.0E-06 |
| sp|Q1GPB6|RS5_SPHAL | 30S ribosomal protein S5 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpsE PE=3 SV=1 | 339 | 497 | 4.0E-06 |
| sp|B9KLA8|RS5_RHOSK | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsE PE=3 SV=1 | 351 | 497 | 4.0E-06 |
| sp|Q3J5Q5|RS5_RHOS4 | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsE PE=3 SV=1 | 351 | 497 | 4.0E-06 |
| sp|A3PGM8|RS5_RHOS1 | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsE PE=3 SV=1 | 351 | 497 | 4.0E-06 |
| sp|Q4K550|RS5_PSEF5 | 30S ribosomal protein S5 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsE PE=3 SV=1 | 351 | 495 | 4.0E-06 |
| sp|B3R7F1|RS5_CUPTR | 30S ribosomal protein S5 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsE PE=3 SV=1 | 335 | 495 | 4.0E-06 |
| sp|Q0K636|RS5_CUPNH | 30S ribosomal protein S5 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsE PE=3 SV=1 | 335 | 495 | 4.0E-06 |
| sp|P59122|RS5_BIFLO | 30S ribosomal protein S5 OS=Bifidobacterium longum (strain NCC 2705) GN=rpsE PE=3 SV=1 | 339 | 495 | 4.0E-06 |
| sp|Q9HWF2|RS5_PSEAE | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsE PE=3 SV=1 | 351 | 495 | 5.0E-06 |
| sp|Q02T63|RS5_PSEAB | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsE PE=3 SV=1 | 351 | 495 | 5.0E-06 |
| sp|B7V661|RS5_PSEA8 | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain LESB58) GN=rpsE PE=3 SV=1 | 351 | 495 | 5.0E-06 |
| sp|A6UZK5|RS5_PSEA7 | 30S ribosomal protein S5 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsE PE=3 SV=1 | 351 | 495 | 5.0E-06 |
| sp|O52349|RS5_MYCGA | 30S ribosomal protein S5 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpsE PE=3 SV=2 | 351 | 492 | 5.0E-06 |
| sp|B8ELE6|RS5_METSB | 30S ribosomal protein S5 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsE PE=3 SV=1 | 351 | 485 | 5.0E-06 |
| sp|Q5GWV1|RS5_XANOR | 30S ribosomal protein S5 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|B2SQS7|RS5_XANOP | 30S ribosomal protein S5 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|Q2P002|RS5_XANOM | 30S ribosomal protein S5 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|P66587|RS5_XANCP | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|B0RU65|RS5_XANCB | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|Q4URF6|RS5_XANC8 | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|Q3BWW6|RS5_XANC5 | 30S ribosomal protein S5 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|P66586|RS5_XANAC | 30S ribosomal protein S5 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpsE PE=3 SV=1 | 339 | 492 | 5.0E-06 |
| sp|A6GZ82|RS5_FLAPJ | 30S ribosomal protein S5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsE PE=3 SV=1 | 351 | 501 | 5.0E-06 |
| sp|Q1MIC4|RS5_RHIL3 | 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsE PE=3 SV=1 | 351 | 491 | 6.0E-06 |
| sp|B5ZYV2|RS5_RHILW | 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsE PE=3 SV=1 | 351 | 491 | 6.0E-06 |
| sp|Q2K9J9|RS5_RHIEC | 30S ribosomal protein S5 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpsE PE=3 SV=1 | 351 | 491 | 6.0E-06 |
| sp|B3PWT8|RS5_RHIE6 | 30S ribosomal protein S5 OS=Rhizobium etli (strain CIAT 652) GN=rpsE PE=3 SV=1 | 351 | 491 | 6.0E-06 |
| sp|B1LWQ9|RS5_METRJ | 30S ribosomal protein S5 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsE PE=3 SV=1 | 351 | 492 | 6.0E-06 |
| sp|Q9X1J2|RS5_THEMA | 30S ribosomal protein S5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsE PE=3 SV=1 | 355 | 485 | 7.0E-06 |
| sp|B9JVQ4|RS5_AGRVS | 30S ribosomal protein S5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsE PE=3 SV=1 | 351 | 491 | 7.0E-06 |
| sp|Q1QN13|RS5_NITHX | 30S ribosomal protein S5 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsE PE=3 SV=1 | 351 | 502 | 7.0E-06 |
| sp|C1DAT4|RS5_LARHH | 30S ribosomal protein S5 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsE PE=3 SV=1 | 403 | 495 | 8.0E-06 |
| sp|A8EZJ9|RS5_RICCK | 30S ribosomal protein S5 OS=Rickettsia canadensis (strain McKiel) GN=rpsE PE=3 SV=1 | 362 | 495 | 9.0E-06 |
| sp|Q7UN03|RS5_RHOBA | 30S ribosomal protein S5 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsE PE=3 SV=1 | 358 | 489 | 9.0E-06 |
| sp|B1Z776|RS5_METPB | 30S ribosomal protein S5 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsE PE=3 SV=1 | 351 | 492 | 9.0E-06 |
| sp|B7IHW3|RS5_THEAB | 30S ribosomal protein S5 OS=Thermosipho africanus (strain TCF52B) GN=rpsE PE=3 SV=1 | 355 | 501 | 9.0E-06 |
| sp|A9W4S3|RS5_METEP | 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain PA1) GN=rpsE PE=3 SV=1 | 351 | 492 | 1.0E-05 |
| sp|B7L0T3|RS5_METC4 | 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsE PE=3 SV=1 | 351 | 492 | 1.0E-05 |
| sp|C1DKN0|RS5_AZOVD | 30S ribosomal protein S5 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpsE PE=3 SV=1 | 351 | 495 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003735 | structural constituent of ribosome | Yes |
| GO:0006412 | translation | Yes |
| GO:0003723 | RNA binding | Yes |
| GO:0005840 | ribosome | Yes |
| GO:0043043 | peptide biosynthetic process | No |
| GO:0043226 | organelle | No |
| GO:0043229 | intracellular organelle | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0044260 | cellular macromolecule metabolic process | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0006518 | peptide metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0009058 | biosynthetic process | No |
| GO:0009987 | cellular process | No |
| GO:0005198 | structural molecule activity | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0044238 | primary metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:0043603 | cellular amide metabolic process | No |
| GO:0043604 | amide biosynthetic process | No |
| GO:0034645 | cellular macromolecule biosynthetic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0003676 | nucleic acid binding | No |
| GO:0009059 | macromolecule biosynthetic process | No |
| GO:0008150 | biological_process | No |
| GO:0005488 | binding | No |
| GO:0043232 | intracellular non-membrane-bounded organelle | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0005575 | cellular_component | No |
| GO:0043228 | non-membrane-bounded organelle | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0019538 | protein metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|3222 MSVARSTRSLFGRRLASSPSPRKGSCPLIQSRPLQSSAPRSARRSRFRNVTAEKLGLTDPARLEAYRQQKFPEYT EEELEALAKTYTPEQMEAIRAGEAAVNPDDMIIQGRLREDMHRLDYVEDFSKMDPRFDVKPESRVIPEEVRWLND SDWLDEYGSKLLGLSLDREEAKLQQATIRALKRVKESKGDEMVDLTMEELDDLEANPKKLEKLLEVSSSSTRSRP KKSDLPPREDDKFQEKLDGLRQAWRTAMEKELDELDRQDDIEQKPEVPSSRSRMEAGTSGLLRKTSAEAPALGKI PGVAGLYKTLVKASDDADDESGAFEEFKRITGMTVQQIESLYCKCIVRRFVANQTRLGKIRSISVMAIAGNGDGW LGLGIAKSTEMGLANDTARMLAIRNMKPIRRYENRTIFGKVKAKVSGTVVELFNKPPGWGIRCPHRIFEICRAVG IHDLAARIPRSKSPMNSVKATVHALMNQPDPDLIALGRGKKMVDVRKVYYGGSVH* |
| Coding | >Ophun1|3222 ATGAGCGTCGCTCGGTCGACGCGCAGCCTCTTTGGCCGGCGTTTGGCCTCATCACCGTCACCGCGGAAAGGCAGC TGCCCTCTGATCCAGAGCCGGCCACTGCAGAGCTCAGCGCCCCGTTCCGCGCGACGATCCCGGTTCCGGAATGTG ACGGCCGAGAAGCTGGGGCTTACGGACCCGGCTCGTCTCGAGGCATACCGGCAGCAGAAGTTCCCGGAATACACC GAGGAAGAGCTCGAGGCGCTGGCCAAGACGTACACGCCCGAGCAGATGGAGGCCATTCGCGCGGGCGAGGCGGCC GTCAACCCGGACGACATGATTATCCAGGGCCGACTTCGCGAGGATATGCACCGGCTTGATTACGTCGAGGATTTC TCAAAGATGGATCCGCGCTTTGACGTCAAGCCTGAGAGTAGGGTGATACCGGAAGAGGTGCGGTGGCTCAACGAC TCGGACTGGCTGGACGAGTACGGATCCAAGCTTCTGGGACTGAGTCTGGACCGCGAGGAGGCCAAGCTTCAGCAG GCGACGATCCGGGCCCTCAAAAGAGTCAAGGAAAGCAAAGGCGATGAAATGGTAGACCTGACCATGGAAGAGCTC GACGACCTCGAAGCGAACCCCAAGAAACTCGAGAAACTCCTCGAAGTCTCCTCTTCTTCCACCAGGAGCCGACCG AAGAAATCCGACCTCCCACCCAGGGAAGACGACAAATTCCAGGAGAAGCTCGACGGGCTACGACAAGCCTGGCGC ACAGCCATGGAAAAAGAACTCGACGAACTCGACCGCCAAGACGACATTGAGCAAAAACCCGAAGTCCCATCTTCC CGCTCACGAATGGAAGCCGGAACCAGCGGTCTCCTCCGCAAAACCTCTGCCGAAGCCCCCGCGCTGGGCAAGATC CCCGGCGTGGCAGGACTCTACAAGACGCTCGTCAAGGCCTCGGACGACGCGGATGATGAGTCGGGCGCGTTTGAG GAGTTCAAGCGCATCACTGGCATGACGGTGCAGCAGATTGAATCGCTGTACTGCAAGTGCATCGTCCGCCGCTTC GTCGCCAACCAGACGCGACTCGGCAAGATTCGAAGCATATCCGTCATGGCCATCGCCGGCAATGGAGACGGCTGG CTCGGTCTCGGCATCGCAAAGTCCACCGAGATGGGTCTCGCCAATGACACGGCGCGAATGCTCGCCATCCGAAAC ATGAAGCCGATAAGACGATACGAGAACCGCACCATCTTCGGCAAGGTGAAGGCCAAAGTCTCGGGCACCGTCGTC GAGTTGTTCAACAAGCCTCCGGGATGGGGAATCCGCTGCCCGCACCGCATCTTCGAAATCTGTCGCGCCGTCGGC ATCCACGACTTGGCCGCCCGCATCCCCCGCTCCAAGAGCCCAATGAACTCGGTCAAGGCGACGGTCCACGCCCTC ATGAACCAGCCCGACCCGGACCTCATAGCTCTCGGCAGGGGGAAGAAGATGGTGGATGTGCGAAAGGTTTACTAC GGGGGGTCTGTGCATTGA |
| Transcript | >Ophun1|3222 ATGAGCGTCGCTCGGTCGACGCGCAGCCTCTTTGGCCGGCGTTTGGCCTCATCACCGTCACCGCGGAAAGGCAGC TGCCCTCTGATCCAGAGCCGGCCACTGCAGAGCTCAGCGCCCCGTTCCGCGCGACGATCCCGGTTCCGGAATGTG ACGGCCGAGAAGCTGGGGCTTACGGACCCGGCTCGTCTCGAGGCATACCGGCAGCAGAAGTTCCCGGAATACACC GAGGAAGAGCTCGAGGCGCTGGCCAAGACGTACACGCCCGAGCAGATGGAGGCCATTCGCGCGGGCGAGGCGGCC GTCAACCCGGACGACATGATTATCCAGGGCCGACTTCGCGAGGATATGCACCGGCTTGATTACGTCGAGGATTTC TCAAAGATGGATCCGCGCTTTGACGTCAAGCCTGAGAGTAGGGTGATACCGGAAGAGGTGCGGTGGCTCAACGAC TCGGACTGGCTGGACGAGTACGGATCCAAGCTTCTGGGACTGAGTCTGGACCGCGAGGAGGCCAAGCTTCAGCAG GCGACGATCCGGGCCCTCAAAAGAGTCAAGGAAAGCAAAGGCGATGAAATGGTAGACCTGACCATGGAAGAGCTC GACGACCTCGAAGCGAACCCCAAGAAACTCGAGAAACTCCTCGAAGTCTCCTCTTCTTCCACCAGGAGCCGACCG AAGAAATCCGACCTCCCACCCAGGGAAGACGACAAATTCCAGGAGAAGCTCGACGGGCTACGACAAGCCTGGCGC ACAGCCATGGAAAAAGAACTCGACGAACTCGACCGCCAAGACGACATTGAGCAAAAACCCGAAGTCCCATCTTCC CGCTCACGAATGGAAGCCGGAACCAGCGGTCTCCTCCGCAAAACCTCTGCCGAAGCCCCCGCGCTGGGCAAGATC CCCGGCGTGGCAGGACTCTACAAGACGCTCGTCAAGGCCTCGGACGACGCGGATGATGAGTCGGGCGCGTTTGAG GAGTTCAAGCGCATCACTGGCATGACGGTGCAGCAGATTGAATCGCTGTACTGCAAGTGCATCGTCCGCCGCTTC GTCGCCAACCAGACGCGACTCGGCAAGATTCGAAGCATATCCGTCATGGCCATCGCCGGCAATGGAGACGGCTGG CTCGGTCTCGGCATCGCAAAGTCCACCGAGATGGGTCTCGCCAATGACACGGCGCGAATGCTCGCCATCCGAAAC ATGAAGCCGATAAGACGATACGAGAACCGCACCATCTTCGGCAAGGTGAAGGCCAAAGTCTCGGGCACCGTCGTC GAGTTGTTCAACAAGCCTCCGGGATGGGGAATCCGCTGCCCGCACCGCATCTTCGAAATCTGTCGCGCCGTCGGC ATCCACGACTTGGCCGCCCGCATCCCCCGCTCCAAGAGCCCAATGAACTCGGTCAAGGCGACGGTCCACGCCCTC ATGAACCAGCCCGACCCGGACCTCATAGCTCTCGGCAGGGGGAAGAAGATGGTGGATGTGCGAAAGGTTTACTAC GGGGGGTCTGTGCATTGA |
| Gene | >Ophun1|3222 ATGAGCGTCGCTCGGTCGACGCGCAGCCTCTTTGGCCGGCGTTTGGCCTCATCACCGTCACCGCGGAAAGGCAGC TGCCCTCTGATCCAGAGCCGGCCACTGCAGAGCTCAGCGCCCCGTTCCGCGCGACGATCCCGGTTCCGGAATGTG ACGGCCGAGAAGCTGGGGCTTACGGACCCGGCTCGTCTCGAGGCATACCGGCAGCAGAAGTTCCCGGAATACACC GAGGAAGAGCTCGAGGCGCTGGCCAAGACGTACACGCCCGAGCAGATGGAGGCCATTCGCGCGGGCGAGGCGGCC GTCAACCCGGACGACATGATTATCCAGGGCCGACTTCGCGAGGATATGCACCGGCTTGATTACGTCGAGGATTTC TCAAAGATGGATCCGCGCTTTGACGTCAAGCCTGAGAGTAGGGTGATACCGGAAGAGGTGCGGTGGCTCAACGAC TCGGACTGGCTGGACGAGTACGGATCCAAGCTTCTGGGACTGAGTCTGGACCGCGAGGAGGCCAAGCTTCAGCAG GCGACGATCCGGGCCCTCAAAAGAGTCAAGGAAAGCAAAGGCGATGAAATGGTAGACCTGACCATGGAAGAGCTC GACGACCTCGAAGCGAACCCCAAGAAACTCGAGAAACTCCTCGAAGTCTCCTCTTCTTCCACCAGGAGCCGACCG AAGAAATCCGACCTCCCACCCAGGGAAGACGACAAATTCCAGGAGAAGCTCGACGGGCTACGACAAGCCTGGCGC ACAGCCATGGAAAAAGAACTCGACGAACTCGACCGCCAAGACGACATTGAGCAAAAACCCGAAGTCCCATCTTCC CGCTCACGAATGGAAGCCGGAACCAGCGGTCTCCTCCGCAAAACCTCTGCCGAAGCCCCCGCGCTGGGCAAGATC CCCGGCGTGGCAGGACTCTACAAGACGCTCGTCAAGGCCTCGGACGACGCGGATGATGAGTCGGGCGCGTTTGAG GAGTTCAAGCGCATCACTGGCATGACGGTGCAGCAGATTGAATCGCTGTACTGCAAGTGCATCGTCCGCCGCTTC GTCGCCAACCAGACGCGACTCGGCAAGATTCGAAGCATATCCGTCATGGCCATCGCCGGCAATGGAGACGGCTGG CTCGGTCTCGGCATCGCAAAGTCCACCGAGATGGGTCTCGCCAATGACACGGCGCGAATGCTCGCCATCCGAAAC ATGAAGCCGATAAGACGATACGAGAACCGCACCATCTTCGGCAAGGTGAAGGCCAAAGTCTCGGGCACCGTCGTC GAGTTGTTCAACAAGCCTCCGGGTACGTTTTGTTGTCTACCACCTGATGCATGGAAAACTGATGATTTGCTTACC TAGGATGGGGAATCCGCTGCCCGCACCGCATCTTCGAAATCTGTCGCGCCGTCGGCATCCACGACTTGGCCGCCC GCATCCCCCGCTCCAAGAGCCCAATGAACTCGGTCAAGGCGACGGTCCACGCCCTCATGAACCAGCCCGACCCGG ACCTCATAGCTCTCGGCAGGGGGAAGAAGATGGTGGATGTGCGAAAGGTTTACTACGGGGGGTCTGTGCATTGA |