Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3218
Gene name
LocationContig_286:18130..19801
Strand+
Gene length (bp)1671
Transcript length (bp)1671
Coding sequence length (bp)1671
Protein length (aa) 557

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01571 GCV_T Aminomethyltransferase folate-binding domain 3.1E-59 137 421
PF08669 GCV_T_C Glycine cleavage T-protein C-terminal barrel domain 1.1E-20 454 530

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14110|GCST_SCHPO Probable aminomethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcv1 PE=3 SV=1 134 537 3.0E-91
sp|O49849|GCST_FLAAN Aminomethyltransferase, mitochondrial OS=Flaveria anomala GN=GDCST PE=3 SV=1 134 538 5.0E-83
sp|P49364|GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum GN=GDCST PE=1 SV=2 134 538 5.0E-82
sp|P49363|GCST_FLAPR Aminomethyltransferase, mitochondrial OS=Flaveria pringlei GN=GDCST PE=2 SV=1 134 538 6.0E-82
sp|O65396|GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=GDCST PE=2 SV=1 112 538 6.0E-81
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14110|GCST_SCHPO Probable aminomethyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcv1 PE=3 SV=1 134 537 3.0E-91
sp|O49849|GCST_FLAAN Aminomethyltransferase, mitochondrial OS=Flaveria anomala GN=GDCST PE=3 SV=1 134 538 5.0E-83
sp|P49364|GCST_PEA Aminomethyltransferase, mitochondrial OS=Pisum sativum GN=GDCST PE=1 SV=2 134 538 5.0E-82
sp|P49363|GCST_FLAPR Aminomethyltransferase, mitochondrial OS=Flaveria pringlei GN=GDCST PE=2 SV=1 134 538 6.0E-82
sp|O65396|GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana GN=GDCST PE=2 SV=1 112 538 6.0E-81
sp|O23936|GCST_FLATR Aminomethyltransferase, mitochondrial OS=Flaveria trinervia GN=GDCST PE=3 SV=1 134 538 2.0E-80
sp|P93256|GCST_MESCR Aminomethyltransferase, mitochondrial OS=Mesembryanthemum crystallinum GN=GDCST PE=2 SV=1 134 537 3.0E-78
sp|P54260|GCST_SOLTU Aminomethyltransferase, mitochondrial OS=Solanum tuberosum GN=GDCST PE=2 SV=1 134 538 1.0E-77
sp|P48015|GCST_YEAST Aminomethyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCV1 PE=1 SV=2 134 537 9.0E-73
sp|P48728|GCST_HUMAN Aminomethyltransferase, mitochondrial OS=Homo sapiens GN=AMT PE=1 SV=1 123 535 9.0E-73
sp|Q8CFA2|GCST_MOUSE Aminomethyltransferase, mitochondrial OS=Mus musculus GN=Amt PE=1 SV=1 117 535 3.0E-72
sp|P25285|GCST_BOVIN Aminomethyltransferase, mitochondrial OS=Bos taurus GN=AMT PE=1 SV=1 123 535 7.0E-72
sp|Q9TSZ7|GCST_CANLF Aminomethyltransferase, mitochondrial OS=Canis lupus familiaris GN=AMT PE=3 SV=1 118 535 3.0E-66
sp|B7K468|GCST_CYAP8 Aminomethyltransferase OS=Cyanothece sp. (strain PCC 8801) GN=gcvT PE=3 SV=1 134 539 1.0E-64
sp|Q54DD3|GCST_DICDI Aminomethyltransferase, mitochondrial OS=Dictyostelium discoideum GN=gcvT PE=3 SV=1 125 537 3.0E-64
sp|P28337|GCST_CHICK Aminomethyltransferase, mitochondrial OS=Gallus gallus GN=AMT PE=2 SV=2 134 535 1.0E-61
sp|Q8YNF7|GCST_NOSS1 Aminomethyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gcvT PE=3 SV=1 134 530 2.0E-57
sp|P54261|GCST_SYNY3 Aminomethyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gcvT PE=3 SV=1 134 536 3.0E-54
sp|A6LP67|GCST_THEM4 Aminomethyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=gcvT PE=3 SV=1 135 530 3.0E-54
sp|Q7V9I2|GCST_PROMA Aminomethyltransferase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gcvT PE=3 SV=1 131 537 1.0E-53
sp|A7Z6M4|GCST_BACMF Aminomethyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gcvT PE=3 SV=1 134 538 2.0E-53
sp|B1HSN7|GCST_LYSSC Aminomethyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=gcvT PE=3 SV=1 134 537 5.0E-53
sp|C5D4A2|GCST_GEOSW Aminomethyltransferase OS=Geobacillus sp. (strain WCH70) GN=gcvT PE=3 SV=1 134 537 8.0E-53
sp|A2CDX3|GCST_PROM3 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9303) GN=gcvT PE=3 SV=1 133 539 2.0E-52
sp|A0AIE9|GCST_LISW6 Aminomethyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gcvT PE=3 SV=1 134 537 3.0E-52
sp|B7GH71|GCST_ANOFW Aminomethyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gcvT PE=3 SV=1 133 537 4.0E-52
sp|B8D1D7|GCST_HALOH Aminomethyltransferase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gcvT PE=3 SV=1 134 531 1.0E-51
sp|Q92C06|GCST_LISIN Aminomethyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gcvT PE=3 SV=1 134 537 3.0E-51
sp|Q7TUI6|GCST_PROMM Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9313) GN=gcvT PE=3 SV=1 133 539 3.0E-51
sp|A4IQV5|GCST_GEOTN Aminomethyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gcvT PE=3 SV=1 134 537 5.0E-51
sp|A6L6X5|GCST_BACV8 Aminomethyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=gcvT PE=3 SV=1 135 530 8.0E-51
sp|Q8Y7D5|GCST_LISMO Aminomethyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gcvT PE=3 SV=1 134 537 1.0E-50
sp|Q7NFJ5|GCST_GLOVI Aminomethyltransferase OS=Gloeobacter violaceus (strain PCC 7421) GN=gcvT PE=3 SV=2 134 537 1.0E-50
sp|Q3AET7|GCST_CARHZ Aminomethyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gcvT PE=3 SV=1 134 530 2.0E-50
sp|A8F8M9|GCST_PSELT Aminomethyltransferase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=gcvT PE=3 SV=1 134 530 2.0E-50
sp|Q5KX76|GCST_GEOKA Aminomethyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=gcvT PE=3 SV=1 134 537 2.0E-50
sp|A6TMY6|GCST_ALKMQ Aminomethyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=gcvT PE=3 SV=1 134 537 3.0E-50
sp|A5GPL8|GCST_SYNPW Aminomethyltransferase OS=Synechococcus sp. (strain WH7803) GN=gcvT PE=3 SV=1 133 538 4.0E-50
sp|B8DFY0|GCST_LISMH Aminomethyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gcvT PE=3 SV=1 134 537 4.0E-50
sp|Q71ZX4|GCST_LISMF Aminomethyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gcvT PE=3 SV=1 134 537 6.0E-50
sp|Q7MUG4|GCST_PORGI Aminomethyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gcvT PE=3 SV=1 135 530 8.0E-50
sp|B2RI74|GCST_PORG3 Aminomethyltransferase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gcvT PE=3 SV=1 135 530 8.0E-50
sp|A6L8T3|GCST_PARD8 Aminomethyltransferase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gcvT PE=3 SV=1 135 530 8.0E-50
sp|B9K6R7|GCST_THENN Aminomethyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=gcvT PE=3 SV=1 134 537 9.0E-50
sp|C1L2Q4|GCST_LISMC Aminomethyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gcvT PE=3 SV=1 134 537 1.0E-49
sp|Q5SKX0|GCST_THET8 Aminomethyltransferase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gcvT PE=3 SV=1 134 531 4.0E-49
sp|A5IKL0|GCST_THEP1 Aminomethyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=gcvT PE=3 SV=1 134 537 4.0E-49
sp|Q8RCV9|GCST_CALS4 Aminomethyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gcvT PE=3 SV=1 134 526 7.0E-49
sp|B1XP99|GCST_SYNP2 Aminomethyltransferase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gcvT PE=3 SV=1 133 530 8.0E-49
sp|P54378|GCST_BACSU Aminomethyltransferase OS=Bacillus subtilis (strain 168) GN=gcvT PE=1 SV=2 134 537 1.0E-48
sp|Q9WY54|GCST_THEMA Aminomethyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gcvT PE=1 SV=1 134 537 1.0E-48
sp|Q67N36|GCST_SYMTH Aminomethyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gcvT PE=3 SV=1 134 537 1.0E-48
sp|Q72LB1|GCST_THET2 Aminomethyltransferase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gcvT PE=3 SV=1 134 531 2.0E-48
sp|B1KWD5|GCST_CLOBM Aminomethyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gcvT PE=3 SV=1 135 530 5.0E-48
sp|C1FTW3|GCST_CLOBJ Aminomethyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gcvT PE=3 SV=1 135 530 5.0E-48
sp|Q65HF9|GCST_BACLD Aminomethyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gcvT PE=3 SV=1 134 537 1.0E-47
sp|B1IEV3|GCST_CLOBK Aminomethyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=gcvT PE=3 SV=1 135 530 1.0E-47
sp|B3QV24|GCST_CHLT3 Aminomethyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=gcvT PE=3 SV=1 135 532 1.0E-47
sp|B1L9U1|GCST_THESQ Aminomethyltransferase OS=Thermotoga sp. (strain RQ2) GN=gcvT PE=3 SV=1 134 537 1.0E-47
sp|C3L1M5|GCST_CLOB6 Aminomethyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gcvT PE=3 SV=1 135 530 2.0E-47
sp|B2FR21|GCST_STRMK Aminomethyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=gcvT PE=3 SV=1 133 545 2.0E-47
sp|Q5WF30|GCST_BACSK Aminomethyltransferase OS=Bacillus clausii (strain KSM-K16) GN=gcvT PE=3 SV=1 134 537 2.0E-47
sp|A7FRV3|GCST_CLOB1 Aminomethyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gcvT PE=3 SV=1 135 530 5.0E-47
sp|Q89YZ6|GCST_BACTN Aminomethyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gcvT PE=3 SV=1 135 530 9.0E-47
sp|Q87EZ6|GCST_XYLFT Aminomethyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gcvT PE=3 SV=1 134 539 1.0E-46
sp|B2I6Q1|GCST_XYLF2 Aminomethyltransferase OS=Xylella fastidiosa (strain M23) GN=gcvT PE=3 SV=1 134 539 1.0E-46
sp|Q9K934|GCST_BACHD Aminomethyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gcvT PE=3 SV=1 134 537 1.0E-46
sp|Q3B5U7|GCST_CHLL7 Aminomethyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gcvT PE=3 SV=1 134 533 2.0E-46
sp|Q634V6|GCST_BACCZ Aminomethyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=gcvT PE=3 SV=1 133 537 2.0E-46
sp|A9VH12|GCST_BACWK Aminomethyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=gcvT PE=3 SV=1 133 537 2.0E-46
sp|B9IXL9|GCST_BACCQ Aminomethyltransferase OS=Bacillus cereus (strain Q1) GN=gcvT PE=3 SV=1 133 537 2.0E-46
sp|B7HNZ1|GCST_BACC7 Aminomethyltransferase OS=Bacillus cereus (strain AH187) GN=gcvT PE=3 SV=1 133 537 2.0E-46
sp|Q730W1|GCST_BACC1 Aminomethyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gcvT PE=3 SV=1 133 537 2.0E-46
sp|Q2YSZ2|GCST_STAAB Aminomethyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gcvT PE=3 SV=1 134 527 2.0E-46
sp|Q5QVA8|GCST_IDILO Aminomethyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gcvT PE=3 SV=1 132 531 2.0E-46
sp|Q6GGG2|GCST_STAAR Aminomethyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|P64226|GCST_STAAW Aminomethyltransferase OS=Staphylococcus aureus (strain MW2) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|A8Z476|GCST_STAAT Aminomethyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|Q6G929|GCST_STAAS Aminomethyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|P64225|GCST_STAAN Aminomethyltransferase OS=Staphylococcus aureus (strain N315) GN=gcvT PE=1 SV=1 134 527 3.0E-46
sp|P64224|GCST_STAAM Aminomethyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|A6QH81|GCST_STAAE Aminomethyltransferase OS=Staphylococcus aureus (strain Newman) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|Q5HFM2|GCST_STAAC Aminomethyltransferase OS=Staphylococcus aureus (strain COL) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|A5IT65|GCST_STAA9 Aminomethyltransferase OS=Staphylococcus aureus (strain JH9) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|Q2FY33|GCST_STAA8 Aminomethyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|Q2FGI5|GCST_STAA3 Aminomethyltransferase OS=Staphylococcus aureus (strain USA300) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|A6U208|GCST_STAA2 Aminomethyltransferase OS=Staphylococcus aureus (strain JH1) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|A7X2S3|GCST_STAA1 Aminomethyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gcvT PE=3 SV=1 134 527 3.0E-46
sp|Q0I682|GCST_SYNS3 Aminomethyltransferase OS=Synechococcus sp. (strain CC9311) GN=gcvT PE=3 SV=1 135 537 3.0E-46
sp|O86567|GCST_STRCO Aminomethyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gcvT PE=3 SV=1 134 530 4.0E-46
sp|A7GSN8|GCST_BACCN Aminomethyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gcvT PE=3 SV=1 133 537 4.0E-46
sp|Q2RH46|GCST_MOOTA Aminomethyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=gcvT PE=3 SV=1 134 538 4.0E-46
sp|B4SSE0|GCST_STRM5 Aminomethyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gcvT PE=3 SV=1 133 545 5.0E-46
sp|Q46I99|GCST_PROMT Aminomethyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=gcvT PE=3 SV=1 134 537 6.0E-46
sp|A7GB83|GCST_CLOBL Aminomethyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gcvT PE=3 SV=1 135 530 7.0E-46
sp|A8MEG4|GCST_ALKOO Aminomethyltransferase OS=Alkaliphilus oremlandii (strain OhILAs) GN=gcvT PE=3 SV=1 134 530 8.0E-46
sp|A4J2F6|GCST_DESRM Aminomethyltransferase OS=Desulfotomaculum reducens (strain MI-1) GN=gcvT PE=3 SV=1 134 537 1.0E-45
sp|B0K242|GCST_THEPX Aminomethyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=gcvT PE=3 SV=1 134 526 1.0E-45
sp|A2C5F7|GCST_PROM1 Aminomethyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=gcvT PE=3 SV=1 134 537 1.0E-45
sp|B0U270|GCST_XYLFM Aminomethyltransferase OS=Xylella fastidiosa (strain M12) GN=gcvT PE=3 SV=1 134 539 2.0E-45
sp|Q8CXD9|GCST_OCEIH Aminomethyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gcvT PE=3 SV=2 134 537 2.0E-45
sp|Q64WS3|GCST_BACFR Aminomethyltransferase OS=Bacteroides fragilis (strain YCH46) GN=gcvT PE=3 SV=1 135 530 2.0E-45
sp|Q5LFT6|GCST_BACFN Aminomethyltransferase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gcvT PE=3 SV=1 135 530 2.0E-45
sp|A9B2Q5|GCST_HERA2 Aminomethyltransferase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gcvT PE=3 SV=1 134 537 3.0E-45
sp|Q6A9R6|GCST_PROAC Aminomethyltransferase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=gcvT PE=3 SV=1 134 537 3.0E-45
sp|C1ERV0|GCST_BACC3 Aminomethyltransferase OS=Bacillus cereus (strain 03BB102) GN=gcvT PE=3 SV=1 133 537 4.0E-45
sp|A0RIL1|GCST_BACAH Aminomethyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=gcvT PE=3 SV=1 133 537 4.0E-45
sp|B0TZJ8|GCST_FRAP2 Aminomethyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gcvT PE=3 SV=1 134 533 5.0E-45
sp|Q9PGW5|GCST_XYLFA Aminomethyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=gcvT PE=3 SV=1 134 539 7.0E-45
sp|Q3BQN6|GCST_XANC5 Aminomethyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gcvT PE=3 SV=1 133 545 9.0E-45
sp|Q8PI37|GCST_XANAC Aminomethyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gcvT PE=3 SV=1 133 545 1.0E-44
sp|Q5H1X3|GCST_XANOR Aminomethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gcvT PE=3 SV=1 133 545 1.0E-44
sp|Q2P4S5|GCST_XANOM Aminomethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gcvT PE=3 SV=1 133 545 1.0E-44
sp|B0KD95|GCST_THEP3 Aminomethyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gcvT PE=3 SV=1 134 526 2.0E-44
sp|Q3AQ17|GCST_CHLCH Aminomethyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=gcvT PE=3 SV=1 134 531 2.0E-44
sp|Q82JI2|GCST_STRAW Aminomethyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gcvT PE=3 SV=1 135 537 4.0E-44
sp|Q7TTS1|GCST_SYNPX Aminomethyltransferase OS=Synechococcus sp. (strain WH8102) GN=gcvT PE=3 SV=1 133 537 5.0E-44
sp|Q8P6T8|GCST_XANCP Aminomethyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gcvT PE=3 SV=1 133 545 5.0E-44
sp|Q4UXC2|GCST_XANC8 Aminomethyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gcvT PE=3 SV=1 133 545 5.0E-44
sp|Q6HDT6|GCST_BACHK Aminomethyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gcvT PE=3 SV=1 133 537 7.0E-44
sp|Q818M3|GCST_BACCR Aminomethyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gcvT PE=3 SV=1 133 537 7.0E-44
sp|B7JMV1|GCST_BACC0 Aminomethyltransferase OS=Bacillus cereus (strain AH820) GN=gcvT PE=3 SV=1 133 537 7.0E-44
sp|Q81M06|GCST_BACAN Aminomethyltransferase OS=Bacillus anthracis GN=gcvT PE=3 SV=1 133 537 7.0E-44
sp|C3LKQ4|GCST_BACAC Aminomethyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gcvT PE=3 SV=1 133 537 7.0E-44
sp|C3P8D5|GCST_BACAA Aminomethyltransferase OS=Bacillus anthracis (strain A0248) GN=gcvT PE=3 SV=1 133 537 7.0E-44
sp|Q1INT8|GCST_KORVE Aminomethyltransferase OS=Koribacter versatilis (strain Ellin345) GN=gcvT PE=3 SV=1 134 538 9.0E-44
sp|Q3JDS3|GCST_NITOC Aminomethyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gcvT PE=3 SV=1 132 531 9.0E-44
sp|B2SSQ1|GCST_XANOP Aminomethyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=gcvT PE=3 SV=1 133 545 2.0E-43
sp|A4IZK8|GCST_FRATW Aminomethyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gcvT PE=3 SV=1 134 533 2.0E-43
sp|B2SFM1|GCST_FRATM Aminomethyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gcvT PE=3 SV=1 134 533 2.0E-43
sp|A8FF41|GCST_BACP2 Aminomethyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=gcvT PE=3 SV=1 134 537 2.0E-43
sp|B7IXL4|GCST_BACC2 Aminomethyltransferase OS=Bacillus cereus (strain G9842) GN=gcvT PE=3 SV=1 133 537 2.0E-43
sp|B8GNE2|GCST_THISH Aminomethyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=gcvT PE=3 SV=1 134 533 3.0E-43
sp|B4S437|GCST_PROA2 Aminomethyltransferase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gcvT PE=3 SV=1 134 532 3.0E-43
sp|Q0BN73|GCST_FRATO Aminomethyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gcvT PE=3 SV=1 134 533 3.0E-43
sp|Q2A4V3|GCST_FRATH Aminomethyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gcvT PE=3 SV=1 134 533 3.0E-43
sp|A7NAH6|GCST_FRATF Aminomethyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gcvT PE=3 SV=1 134 533 3.0E-43
sp|A5GWT1|GCST_SYNR3 Aminomethyltransferase OS=Synechococcus sp. (strain RCC307) GN=gcvT PE=3 SV=1 135 537 3.0E-43
sp|Q8DKV6|GCST_THEEB Aminomethyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=gcvT PE=3 SV=1 133 538 5.0E-43
sp|A0Q585|GCST_FRATN Aminomethyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=gcvT PE=3 SV=1 134 533 6.0E-43
sp|Q5NHP0|GCST_FRATT Aminomethyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gcvT PE=3 SV=1 134 533 9.0E-43
sp|Q14J42|GCST_FRAT1 Aminomethyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gcvT PE=3 SV=1 134 533 9.0E-43
sp|A6GXW3|GCST_FLAPJ Aminomethyltransferase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=gcvT PE=3 SV=1 134 530 1.0E-42
sp|Q8F935|GCST_LEPIN Aminomethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gcvT PE=3 SV=2 131 537 2.0E-42
sp|Q72VI6|GCST_LEPIC Aminomethyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gcvT PE=3 SV=2 131 537 2.0E-42
sp|B2A2T4|GCST_NATTJ Aminomethyltransferase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=gcvT PE=3 SV=1 133 537 3.0E-42
sp|Q4L6N7|GCST_STAHJ Aminomethyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gcvT PE=3 SV=1 134 532 5.0E-42
sp|A9I7L6|GCST_BORPD Aminomethyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=gcvT PE=3 SV=1 134 531 6.0E-42
sp|Q3AVT0|GCST_SYNS9 Aminomethyltransferase OS=Synechococcus sp. (strain CC9902) GN=gcvT PE=3 SV=1 134 538 7.0E-42
sp|Q8CSF4|GCST_STAES Aminomethyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gcvT PE=3 SV=1 134 532 1.0E-41
sp|Q5HP12|GCST_STAEQ Aminomethyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gcvT PE=3 SV=1 134 532 1.0E-41
sp|B7HBA0|GCST_BACC4 Aminomethyltransferase OS=Bacillus cereus (strain B4264) GN=gcvT PE=3 SV=1 133 537 1.0E-41
sp|A4FLG1|GCST_SACEN Aminomethyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=gcvT PE=3 SV=1 134 537 2.0E-41
sp|B4SED4|GCST_PELPB Aminomethyltransferase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gcvT PE=3 SV=1 134 533 3.0E-41
sp|Q7TU18|GCST_PROMP Aminomethyltransferase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gcvT PE=3 SV=1 134 530 4.0E-41
sp|A4SDB4|GCST_CHLPM Aminomethyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gcvT PE=3 SV=1 134 532 6.0E-41
sp|Q486J8|GCST_COLP3 Aminomethyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=gcvT PE=3 SV=1 133 531 8.0E-41
sp|Q055P6|GCST_LEPBL Aminomethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gcvT PE=3 SV=1 131 537 9.0E-41
sp|B9DNN7|GCST_STACT Aminomethyltransferase OS=Staphylococcus carnosus (strain TM300) GN=gcvT PE=3 SV=1 134 527 1.0E-40
sp|Q1AR89|GCST_RUBXD Aminomethyltransferase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=gcvT PE=3 SV=1 134 546 1.0E-40
sp|Q04PM9|GCST_LEPBJ Aminomethyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gcvT PE=3 SV=1 131 537 2.0E-40
sp|A2BZ74|GCST_PROM5 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9515) GN=gcvT PE=3 SV=1 134 530 2.0E-40
sp|Q7NSJ3|GCST_CHRVO Aminomethyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gcvT PE=3 SV=1 134 531 3.0E-40
sp|Q82WQ6|GCST_NITEU Aminomethyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gcvT PE=3 SV=1 135 531 3.0E-40
sp|Q0VLA6|GCST_ALCBS Aminomethyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gcvT PE=3 SV=1 133 531 5.0E-40
sp|Q3IFV9|GCST_PSEHT Aminomethyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gcvT PE=3 SV=1 134 501 5.0E-40
sp|Q24TH3|GCST_DESHY Aminomethyltransferase OS=Desulfitobacterium hafniense (strain Y51) GN=gcvT PE=3 SV=1 134 530 7.0E-40
sp|Q49XY1|GCST_STAS1 Aminomethyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gcvT PE=3 SV=1 134 511 8.0E-40
sp|Q83B06|GCST_COXBU Aminomethyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gcvT PE=3 SV=1 135 531 1.0E-39
sp|B6YY21|GCST_THEON Probable aminomethyltransferase OS=Thermococcus onnurineus (strain NA1) GN=gcvT PE=3 SV=1 134 534 1.0E-39
sp|B2UG80|GCST_RALPJ Aminomethyltransferase OS=Ralstonia pickettii (strain 12J) GN=gcvT PE=3 SV=1 133 531 2.0E-39
sp|B8FT33|GCST_DESHD Aminomethyltransferase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=gcvT PE=3 SV=1 134 530 2.0E-39
sp|B3EFX7|GCST_CHLL2 Aminomethyltransferase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gcvT PE=3 SV=1 134 532 2.0E-39
sp|A1BI02|GCST_CHLPD Aminomethyltransferase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gcvT PE=3 SV=1 134 533 2.0E-39
sp|B3QLF1|GCST_CHLP8 Aminomethyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=gcvT PE=3 SV=1 134 532 3.0E-39
sp|O58888|GCST_PYRHO Probable aminomethyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gcvT PE=1 SV=2 134 534 3.0E-39
sp|Q8U185|GCST_PYRFU Probable aminomethyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gcvT PE=3 SV=1 134 534 5.0E-39
sp|Q666R5|GCST_YERPS Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gcvT PE=3 SV=1 134 531 8.0E-39
sp|A7FF19|GCST_YERP3 Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gcvT PE=3 SV=1 134 531 8.0E-39
sp|Q15PU4|GCST_PSEA6 Aminomethyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gcvT PE=3 SV=1 133 531 8.0E-39
sp|Q2KYM2|GCST_BORA1 Aminomethyltransferase OS=Bordetella avium (strain 197N) GN=gcvT PE=3 SV=1 135 531 8.0E-39
sp|Q7N197|GCST_PHOLL Aminomethyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gcvT PE=3 SV=1 134 531 9.0E-39
sp|Q4JXU5|GCST_CORJK Aminomethyltransferase OS=Corynebacterium jeikeium (strain K411) GN=gcvT PE=3 SV=1 134 530 1.0E-38
sp|A5I9T7|GCST_LEGPC Aminomethyltransferase OS=Legionella pneumophila (strain Corby) GN=gcvT PE=3 SV=1 134 532 1.0E-38
sp|A4TIA5|GCST_YERPP Aminomethyltransferase OS=Yersinia pestis (strain Pestoides F) GN=gcvT PE=3 SV=1 134 531 1.0E-38
sp|Q1CEZ7|GCST_YERPN Aminomethyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gcvT PE=3 SV=1 134 531 1.0E-38
sp|A9R4K6|GCST_YERPG Aminomethyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gcvT PE=3 SV=1 134 531 1.0E-38
sp|Q8ZHI6|GCST_YERPE Aminomethyltransferase OS=Yersinia pestis GN=gcvT PE=3 SV=1 134 531 1.0E-38
sp|B2K0Q5|GCST_YERPB Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gcvT PE=3 SV=1 134 531 1.0E-38
sp|Q1CB44|GCST_YERPA Aminomethyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gcvT PE=3 SV=1 134 531 1.0E-38
sp|B1JNS6|GCST_YERPY Aminomethyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gcvT PE=3 SV=1 134 531 1.0E-38
sp|Q47D83|GCST_DECAR Aminomethyltransferase OS=Dechloromonas aromatica (strain RCB) GN=gcvT PE=3 SV=1 134 530 1.0E-38
sp|Q5X0A4|GCST_LEGPL Aminomethyltransferase OS=Legionella pneumophila (strain Lens) GN=gcvT PE=3 SV=1 134 532 1.0E-38
sp|C3PHK3|GCST_CORA7 Aminomethyltransferase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=gcvT PE=3 SV=1 134 537 2.0E-38
sp|B2JJ71|GCST_BURP8 Aminomethyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gcvT PE=3 SV=1 134 531 2.0E-38
sp|Q9K0L8|GCST_NEIMB Aminomethyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gcvT PE=3 SV=1 135 539 2.0E-38
sp|A1JPN6|GCST_YERE8 Aminomethyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gcvT PE=3 SV=1 134 531 2.0E-38
sp|Q9UZP8|GCST_PYRAB Probable aminomethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gcvT PE=3 SV=1 134 534 2.0E-38
sp|Q5ZZ93|GCST_LEGPH Aminomethyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gcvT PE=3 SV=2 134 532 2.0E-38
sp|C1F933|GCST_ACIC5 Aminomethyltransferase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gcvT PE=3 SV=1 134 538 3.0E-38
sp|Q0K5P5|GCST_CUPNH Aminomethyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=gcvT PE=3 SV=1 135 531 3.0E-38
sp|Q1LHM4|GCST_CUPMC Aminomethyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gcvT PE=3 SV=1 135 531 3.0E-38
sp|Q8KBJ9|GCST_CHLTE Aminomethyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gcvT PE=3 SV=1 134 533 3.0E-38
sp|Q5X8W1|GCST_LEGPA Aminomethyltransferase OS=Legionella pneumophila (strain Paris) GN=gcvT PE=3 SV=1 134 532 4.0E-38
sp|Q5JDG3|GCST_THEKO Probable aminomethyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gcvT PE=3 SV=1 134 534 4.0E-38
sp|Q7W1C6|GCST_BORPA Aminomethyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=gcvT PE=3 SV=1 134 531 5.0E-38
sp|Q46VZ7|GCST_CUPPJ Aminomethyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gcvT PE=3 SV=1 135 531 5.0E-38
sp|A8GIS1|GCST_SERP5 Aminomethyltransferase OS=Serratia proteamaculans (strain 568) GN=gcvT PE=3 SV=1 134 531 5.0E-38
sp|B1YQQ3|GCST_BURA4 Aminomethyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=gcvT PE=3 SV=1 133 531 6.0E-38
sp|A3QHI2|GCST_SHELP Aminomethyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gcvT PE=3 SV=1 133 531 6.0E-38
sp|A4SP35|GCST_AERS4 Aminomethyltransferase OS=Aeromonas salmonicida (strain A449) GN=gcvT PE=3 SV=1 135 531 7.0E-38
sp|Q88CI7|GCST_PSEPK Aminomethyltransferase OS=Pseudomonas putida (strain KT2440) GN=gcvT PE=3 SV=1 132 531 7.0E-38
sp|Q9HTX5|GCST_PSEAE Aminomethyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gcvT PE=3 SV=1 132 538 8.0E-38
sp|B1YLN6|GCST_EXIS2 Aminomethyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=gcvT PE=3 SV=1 134 537 1.0E-37
sp|B4RSJ5|GCST_ALTMD Aminomethyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=gcvT PE=3 SV=1 135 517 1.0E-37
sp|Q63PL4|GCST_BURPS Aminomethyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=gcvT PE=3 SV=1 135 531 1.0E-37
sp|A3NEZ8|GCST_BURP6 Aminomethyltransferase OS=Burkholderia pseudomallei (strain 668) GN=gcvT PE=3 SV=1 135 531 1.0E-37
sp|A3P0U5|GCST_BURP0 Aminomethyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=gcvT PE=3 SV=1 135 531 1.0E-37
sp|Q62FM9|GCST_BURMA Aminomethyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=gcvT PE=3 SV=1 135 531 1.0E-37
sp|A2S6F4|GCST_BURM9 Aminomethyltransferase OS=Burkholderia mallei (strain NCTC 10229) GN=gcvT PE=3 SV=1 135 531 1.0E-37
sp|A3MQP5|GCST_BURM7 Aminomethyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=gcvT PE=3 SV=1 135 531 1.0E-37
sp|A1S967|GCST_SHEAM Aminomethyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gcvT PE=3 SV=1 133 531 1.0E-37
sp|Q07YC7|GCST_SHEFN Aminomethyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=gcvT PE=3 SV=1 134 531 1.0E-37
sp|Q0AEP7|GCST_NITEC Aminomethyltransferase OS=Nitrosomonas eutropha (strain C91) GN=gcvT PE=3 SV=1 135 531 2.0E-37
sp|Q7WP31|GCST_BORBR Aminomethyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=gcvT PE=3 SV=1 134 531 2.0E-37
sp|Q60BW3|GCST_METCA Aminomethyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gcvT PE=3 SV=1 132 531 2.0E-37
sp|B0SQA1|GCST_LEPBP Aminomethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gcvT PE=3 SV=1 134 537 2.0E-37
sp|B0SGN8|GCST_LEPBA Aminomethyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gcvT PE=3 SV=1 134 537 2.0E-37
sp|A1WWA3|GCST_HALHL Aminomethyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gcvT PE=3 SV=1 133 531 3.0E-37
sp|Q5N136|GCST_SYNP6 Aminomethyltransferase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gcvT PE=3 SV=1 135 530 3.0E-37
sp|Q31KT1|GCST_SYNE7 Aminomethyltransferase OS=Synechococcus elongatus (strain PCC 7942) GN=gcvT PE=3 SV=1 135 530 3.0E-37
sp|Q6D976|GCST_PECAS Aminomethyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gcvT PE=3 SV=1 134 531 3.0E-37
sp|A9ACU5|GCST_BURM1 Aminomethyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gcvT PE=3 SV=1 135 531 3.0E-37
sp|B3R7J7|GCST_CUPTR Aminomethyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gcvT PE=3 SV=1 135 531 3.0E-37
sp|Q7W0E5|GCST_BORPE Aminomethyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gcvT PE=3 SV=1 134 531 4.0E-37
sp|B1JSZ4|GCST_BURCC Aminomethyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=gcvT PE=3 SV=1 133 531 4.0E-37
sp|B8CK16|GCST_SHEPW Aminomethyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=gcvT PE=3 SV=1 133 531 5.0E-37
sp|C5A3P0|GCST_THEGJ Probable aminomethyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gcvT PE=3 SV=1 134 534 7.0E-37
sp|Q6MQ03|GCST_BDEBA Aminomethyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gcvT PE=3 SV=1 134 531 8.0E-37
sp|B4EF28|GCST_BURCJ Aminomethyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gcvT PE=3 SV=1 133 531 1.0E-36
sp|A8APB4|GCST_CITK8 Aminomethyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gcvT PE=3 SV=1 133 531 2.0E-36
sp|A8H7T1|GCST_SHEPA Aminomethyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gcvT PE=3 SV=1 133 531 2.0E-36
sp|Q39KT9|GCST_BURL3 Aminomethyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=gcvT PE=3 SV=1 133 531 2.0E-36
sp|A6TDR7|GCST_KLEP7 Aminomethyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gcvT PE=3 SV=1 133 531 3.0E-36
sp|Q9JVP2|GCST_NEIMA Aminomethyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gcvT PE=3 SV=2 135 539 3.0E-36
sp|A8G7J2|GCST_PROM2 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9215) GN=gcvT PE=3 SV=1 134 535 3.0E-36
sp|B7N7E8|GCST_ECOLU Aminomethyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gcvT PE=3 SV=1 133 531 4.0E-36
sp|Q8XUA0|GCST_RALSO Aminomethyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=gcvT PE=3 SV=1 133 531 5.0E-36
sp|B1LDA5|GCST_ECOSM Aminomethyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gcvT PE=3 SV=1 133 531 6.0E-36
sp|B5YQ97|GCST_ECO5E Aminomethyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gcvT PE=3 SV=1 133 531 6.0E-36
sp|Q8XD32|GCST_ECO57 Aminomethyltransferase OS=Escherichia coli O157:H7 GN=gcvT PE=3 SV=1 133 531 6.0E-36
sp|Q3YXW5|GCST_SHISS Aminomethyltransferase OS=Shigella sonnei (strain Ss046) GN=gcvT PE=3 SV=1 133 531 8.0E-36
sp|C1D0F7|GCST_DEIDV Aminomethyltransferase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gcvT PE=3 SV=1 134 532 8.0E-36
sp|A7MR82|GCST_CROS8 Aminomethyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gcvT PE=3 SV=1 133 531 8.0E-36
sp|Q0T0Z3|GCST_SHIF8 Aminomethyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=gcvT PE=3 SV=1 132 531 9.0E-36
sp|A4JA71|GCST_BURVG Aminomethyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gcvT PE=3 SV=1 133 531 9.0E-36
sp|A9MRH0|GCST_SALAR Aminomethyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|Q31WG6|GCST_SHIBS Aminomethyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|B2U0S2|GCST_SHIB3 Aminomethyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|B6I738|GCST_ECOSE Aminomethyltransferase OS=Escherichia coli (strain SE11) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|P27248|GCST_ECOLI Aminomethyltransferase OS=Escherichia coli (strain K12) GN=gcvT PE=1 SV=3 133 531 1.0E-35
sp|B1IT97|GCST_ECOLC Aminomethyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|A8A446|GCST_ECOHS Aminomethyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|C5A0H7|GCST_ECOBW Aminomethyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|B7LYG9|GCST_ECO8A Aminomethyltransferase OS=Escherichia coli O8 (strain IAI1) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|B7LF91|GCST_ECO55 Aminomethyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|A7ZR14|GCST_ECO24 Aminomethyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|Q83JU1|GCST_SHIFL Aminomethyltransferase OS=Shigella flexneri GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|A9N3N3|GCST_SALPB Aminomethyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gcvT PE=3 SV=1 133 531 1.0E-35
sp|A0KJ03|GCST_AERHH Aminomethyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gcvT PE=3 SV=1 135 531 1.0E-35
sp|A3PFH6|GCST_PROM0 Aminomethyltransferase OS=Prochlorococcus marinus (strain MIT 9301) GN=gcvT PE=3 SV=1 134 535 1.0E-35
sp|B0TSG7|GCST_SHEHH Aminomethyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gcvT PE=3 SV=1 133 531 2.0E-35
sp|O67441|GCST_AQUAE Aminomethyltransferase OS=Aquifex aeolicus (strain VF5) GN=gcvT PE=3 SV=2 134 537 2.0E-35
sp|A2BTR9|GCST_PROMS Aminomethyltransferase OS=Prochlorococcus marinus (strain AS9601) GN=gcvT PE=3 SV=1 134 535 2.0E-35
sp|Q3IN28|GCST_NATPD Probable aminomethyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gcvT PE=3 SV=1 136 532 2.0E-35
sp|C0PY28|GCST_SALPC Aminomethyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=gcvT PE=3 SV=1 133 531 2.0E-35
sp|B4T550|GCST_SALNS Aminomethyltransferase OS=Salmonella newport (strain SL254) GN=gcvT PE=3 SV=1 133 531 2.0E-35
sp|B4TGX5|GCST_SALHS Aminomethyltransferase OS=Salmonella heidelberg (strain SL476) GN=gcvT PE=3 SV=1 133 531 2.0E-35
sp|Q57K60|GCST_SALCH Aminomethyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=gcvT PE=3 SV=1 133 531 2.0E-35
sp|B5FUG8|GCST_SALDC Aminomethyltransferase OS=Salmonella dublin (strain CT_02021853) GN=gcvT PE=3 SV=1 133 531 3.0E-35
sp|C5BAT2|GCST_EDWI9 Aminomethyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=gcvT PE=3 SV=1 134 531 3.0E-35
sp|P64222|GCST_SALTY Aminomethyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|P64223|GCST_SALTI Aminomethyltransferase OS=Salmonella typhi GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B4TV24|GCST_SALSV Aminomethyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B5BFM0|GCST_SALPK Aminomethyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|Q5PJG4|GCST_SALPA Aminomethyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B5F5I0|GCST_SALA4 Aminomethyltransferase OS=Salmonella agona (strain SL483) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B5RE16|GCST_SALG2 Aminomethyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B5QXI2|GCST_SALEP Aminomethyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B7LPB9|GCST_ESCF3 Aminomethyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|Q1R7C6|GCST_ECOUT Aminomethyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B7NHW6|GCST_ECO7I Aminomethyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B7MM91|GCST_ECO45 Aminomethyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|B7UHV3|GCST_ECO27 Aminomethyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|Q8FE65|GCST_ECOL6 Aminomethyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gcvT PE=3 SV=1 133 531 4.0E-35
sp|A1RFY6|GCST_SHESW Aminomethyltransferase OS=Shewanella sp. (strain W3-18-1) GN=gcvT PE=3 SV=1 132 531 5.0E-35
sp|A4YAE0|GCST_SHEPC Aminomethyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gcvT PE=3 SV=1 132 531 5.0E-35
sp|Q32BW7|GCST_SHIDS Aminomethyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gcvT PE=3 SV=1 133 531 5.0E-35
sp|B7MZ57|GCST_ECO81 Aminomethyltransferase OS=Escherichia coli O81 (strain ED1a) GN=gcvT PE=3 SV=1 133 531 6.0E-35
sp|B8EB47|GCST_SHEB2 Aminomethyltransferase OS=Shewanella baltica (strain OS223) GN=gcvT PE=3 SV=1 133 531 8.0E-35
sp|B4F0N9|GCST_PROMH Aminomethyltransferase OS=Proteus mirabilis (strain HI4320) GN=gcvT PE=3 SV=1 134 533 1.0E-34
sp|A4WE57|GCST_ENT38 Aminomethyltransferase OS=Enterobacter sp. (strain 638) GN=gcvT PE=3 SV=1 132 531 2.0E-34
sp|A6WSL3|GCST_SHEB8 Aminomethyltransferase OS=Shewanella baltica (strain OS185) GN=gcvT PE=3 SV=1 133 531 3.0E-34
sp|Q2NRE8|GCST_SODGM Aminomethyltransferase OS=Sodalis glossinidius (strain morsitans) GN=gcvT PE=3 SV=1 133 531 3.0E-34
sp|A3D083|GCST_SHEB5 Aminomethyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gcvT PE=3 SV=1 133 531 3.0E-34
sp|A8FZK6|GCST_SHESH Aminomethyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=gcvT PE=3 SV=1 133 531 3.0E-34
sp|A9L332|GCST_SHEB9 Aminomethyltransferase OS=Shewanella baltica (strain OS195) GN=gcvT PE=3 SV=1 133 531 4.0E-34
sp|A0L105|GCST_SHESA Aminomethyltransferase OS=Shewanella sp. (strain ANA-3) GN=gcvT PE=3 SV=1 132 531 4.0E-34
sp|Q0HEX0|GCST_SHESM Aminomethyltransferase OS=Shewanella sp. (strain MR-4) GN=gcvT PE=3 SV=1 132 531 5.0E-34
sp|C6D8W9|GCST_PECCP Aminomethyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gcvT PE=3 SV=1 134 531 5.0E-34
sp|Q21NX7|GCST_SACD2 Aminomethyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gcvT PE=3 SV=1 133 531 7.0E-34
sp|Q0HZ30|GCST_SHESR Aminomethyltransferase OS=Shewanella sp. (strain MR-7) GN=gcvT PE=3 SV=1 132 531 1.0E-33
sp|O32955|GCST_MYCLE Aminomethyltransferase OS=Mycobacterium leprae (strain TN) GN=gcvT PE=3 SV=1 134 536 1.0E-33
sp|B8ZQK6|GCST_MYCLB Aminomethyltransferase OS=Mycobacterium leprae (strain Br4923) GN=gcvT PE=3 SV=1 134 536 1.0E-33
sp|C5BM95|GCST_TERTT Aminomethyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gcvT PE=3 SV=1 134 533 1.0E-33
sp|Q12R04|GCST_SHEDO Aminomethyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gcvT PE=3 SV=1 132 531 1.0E-33
sp|Q8EIQ8|GCST_SHEON Aminomethyltransferase OS=Shewanella oneidensis (strain MR-1) GN=gcvT PE=3 SV=1 132 531 2.0E-33
sp|Q73YK4|GCST_MYCPA Aminomethyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gcvT PE=3 SV=1 136 536 2.0E-33
sp|B2VF35|GCST_ERWT9 Aminomethyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gcvT PE=3 SV=1 133 531 3.0E-33
sp|P9WN51|GCST_MYCTU Aminomethyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gcvT PE=1 SV=1 136 536 6.0E-33
sp|P9WN50|GCST_MYCTO Aminomethyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gcvT PE=3 SV=1 136 536 6.0E-33
sp|P64221|GCST_MYCBO Aminomethyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gcvT PE=3 SV=1 136 536 6.0E-33
sp|A0QEZ6|GCST_MYCA1 Aminomethyltransferase OS=Mycobacterium avium (strain 104) GN=gcvT PE=3 SV=1 136 536 6.0E-33
sp|B3PI82|GCST_CELJU Aminomethyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=gcvT PE=3 SV=1 132 531 1.0E-32
sp|B1KG89|GCST_SHEWM Aminomethyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=gcvT PE=3 SV=1 131 531 2.0E-32
sp|Q88AS0|GCST_PSESM Aminomethyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gcvT PE=3 SV=1 132 531 5.0E-31
sp|Q5V230|GCST_HALMA Probable aminomethyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gcvT PE=3 SV=2 136 532 8.0E-31
sp|A0PTP8|GCST_MYCUA Aminomethyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=gcvT PE=3 SV=1 136 536 8.0E-30
sp|A8LFB7|GCST_FRASN Aminomethyltransferase OS=Frankia sp. (strain EAN1pec) GN=gcvT PE=3 SV=1 134 536 3.0E-29
sp|Q5YZ49|GCST_NOCFA Aminomethyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=gcvT PE=3 SV=1 134 534 3.0E-28
sp|Q0RFF6|GCST_FRAAA Aminomethyltransferase OS=Frankia alni (strain ACN14a) GN=gcvT PE=3 SV=1 134 536 4.0E-28
sp|Q9HPJ7|GCST_HALSA Probable aminomethyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gcvT PE=3 SV=2 135 532 3.0E-27
sp|B0R5Y8|GCST_HALS3 Probable aminomethyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gcvT PE=3 SV=1 135 532 3.0E-27
sp|Q9YBA2|GCST_AERPE Probable aminomethyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gcvT PE=3 SV=2 133 531 1.0E-24
sp|O87386|SOXA_RHIME Sarcosine oxidase subunit alpha OS=Rhizobium meliloti (strain 1021) GN=soxA PE=3 SV=2 128 514 3.0E-17
sp|Q9AGP1|SOXA_ARTSP Sarcosine oxidase subunit alpha OS=Arthrobacter sp. GN=soxA PE=1 SV=1 135 545 1.0E-13
sp|Q9UI17|M2GD_HUMAN Dimethylglycine dehydrogenase, mitochondrial OS=Homo sapiens GN=DMGDH PE=1 SV=2 181 533 3.0E-13
sp|Q8GAI3|MABO1_ARTNI 4-methylaminobutanoate oxidase (formaldehyde-forming) OS=Arthrobacter nicotinovorans GN=abo PE=1 SV=1 163 545 4.0E-13
sp|Q5LS57|DMDA_RUEPO Dimethylsulfonioproprionate demethylase DmdA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdA PE=1 SV=1 176 525 8.0E-13
sp|Q46337|SOXA_CORS1 Sarcosine oxidase subunit alpha OS=Corynebacterium sp. (strain P-1) GN=soxA PE=1 SV=1 135 545 1.0E-12
sp|Q9DBT9|M2GD_MOUSE Dimethylglycine dehydrogenase, mitochondrial OS=Mus musculus GN=Dmgdh PE=1 SV=1 217 533 2.0E-12
sp|Q63342|M2GD_RAT Dimethylglycine dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Dmgdh PE=1 SV=1 181 533 2.0E-12
sp|Q9AGP8|DMGO_ARTGO Dimethylglycine oxidase OS=Arthrobacter globiformis GN=dmg PE=1 SV=1 171 540 2.0E-11
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2162
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5571
Ophiocordyceps australis map64 (Brazil) OphauB2|7798
Ophiocordyceps camponoti-floridani Ophcf2|07372
Ophiocordyceps camponoti-rufipedis Ophun1|3218 (this protein)
Ophiocordyceps kimflemingae Ophio5|8205
Ophiocordyceps subramaniannii Hirsu2|2668

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3218
MRTGIRSLVRAAVRLPRAPAARFSVTARVLTDGESKVKGGEALKVNGGSKLAGVQATVENPTTAEVPGTDEASKP
VDENPATAENSTTTEPAEPAEPAMPADWDRRYDFIELEELDEPMGQRRGYNYGQHQGHRTPLYDFHIRHEADLVA
YANHKLPIMYPKYGTITQSHFTTRINASFWDVSHMVQHIVQGDEAAKCLELLTPGAWRTAPLMRAKLTTFLWPTG
GIVDDAVVTKLAEDKFYIVTNGATREKIMEYLREQLADVRKSEKEGDGGLDWTIADRKALLALQGPDSQSIISNL
LPEDETRVDLDKLYFGDAFFSKLHIENDVRTPYDILITRGGYTGEDGFELSFAFGNDEARNIGYNVAGRVADSLM
RSDPDGMVLPSGLGTRDTLRLEAGLCLYGQDLDDKTTPVEAGLGWVVSPERRVSGGFLGADVIIPQLTPKSKGGA
GVWRRRIGMVAESGRPARHGAKIYHKGREVGAVTSGIPSPSLQVNIAMGYVEDGLHKVGTELEVDVRKRMEKVTV
VKMPFIETRYRRPDGDRQPGSVPWAEPQTPE*
Coding >Ophun1|3218
ATGCGGACTGGAATCAGGAGCCTTGTGCGCGCGGCTGTTCGGCTGCCGCGGGCGCCGGCGGCGCGCTTTTCGGTG
ACGGCGAGGGTTTTGACGGATGGGGAGTCGAAGGTGAAGGGGGGGGAGGCTTTGAAGGTGAACGGGGGTTCGAAG
CTGGCTGGGGTTCAGGCGACGGTTGAGAATCCAACGACGGCTGAGGTTCCGGGGACGGATGAGGCCTCGAAGCCG
GTTGATGAGAATCCGGCGACGGCTGAGAATTCGACGACAACAGAGCCCGCCGAGCCCGCCGAGCCCGCTATGCCC
GCCGATTGGGACAGACGGTACGATTTCATAGAACTGGAAGAGCTTGACGAGCCCATGGGGCAGAGACGAGGATAC
AATTACGGACAGCACCAAGGGCATAGGACGCCGTTGTACGACTTTCACATCCGGCACGAAGCTGACCTGGTCGCC
TACGCAAACCACAAGCTGCCGATCATGTACCCGAAGTATGGCACCATCACACAATCGCACTTCACCACCCGCATC
AATGCCTCCTTCTGGGACGTCAGCCACATGGTGCAACACATAGTCCAGGGCGACGAGGCGGCCAAGTGTCTCGAG
CTCTTGACGCCGGGGGCGTGGCGGACGGCGCCGTTGATGAGGGCCAAGTTGACGACGTTTCTCTGGCCTACTGGC
GGCATCGTCGATGATGCCGTCGTCACCAAGTTGGCCGAGGATAAGTTCTACATCGTCACCAACGGGGCGACTCGC
GAGAAGATCATGGAATACTTGAGGGAGCAGCTTGCGGACGTGCGCAAATCCGAGAAGGAGGGTGACGGGGGGCTC
GATTGGACAATAGCGGACAGAAAGGCGCTGCTGGCGCTGCAGGGTCCGGATTCTCAGAGCATCATAAGCAATCTT
CTCCCCGAGGACGAGACGCGGGTCGACCTCGACAAGCTTTACTTTGGCGATGCCTTTTTCAGCAAGCTACATATC
GAGAATGATGTGAGGACGCCGTACGACATCCTCATCACGCGGGGAGGCTACACGGGCGAGGACGGCTTCGAGCTC
TCGTTTGCCTTTGGCAATGATGAGGCCAGAAATATCGGCTACAACGTGGCCGGTCGGGTGGCCGACTCTTTGATG
AGGTCGGACCCGGACGGGATGGTGCTGCCGTCGGGGCTCGGCACGCGCGACACGCTGCGGCTCGAGGCCGGTCTC
TGTCTGTACGGCCAAGATCTCGACGACAAGACGACGCCGGTCGAGGCCGGACTCGGCTGGGTCGTTTCTCCCGAG
AGGCGGGTTTCGGGCGGCTTTCTCGGCGCCGACGTCATCATCCCTCAACTGACACCCAAGAGCAAAGGCGGCGCG
GGCGTTTGGCGGAGGCGCATCGGCATGGTTGCCGAGTCTGGGCGACCGGCGCGGCATGGAGCCAAGATCTATCAC
AAGGGGCGGGAGGTTGGCGCCGTGACGAGCGGGATCCCCAGCCCGTCGCTGCAGGTGAATATCGCCATGGGATAT
GTCGAGGACGGGCTGCACAAGGTTGGCACCGAGCTCGAGGTCGACGTCCGCAAGAGGATGGAGAAGGTGACGGTT
GTCAAGATGCCGTTTATCGAAACGCGGTATCGTAGGCCTGATGGGGATAGGCAGCCGGGTAGCGTACCCTGGGCA
GAGCCGCAGACTCCCGAATGA
Transcript >Ophun1|3218
ATGCGGACTGGAATCAGGAGCCTTGTGCGCGCGGCTGTTCGGCTGCCGCGGGCGCCGGCGGCGCGCTTTTCGGTG
ACGGCGAGGGTTTTGACGGATGGGGAGTCGAAGGTGAAGGGGGGGGAGGCTTTGAAGGTGAACGGGGGTTCGAAG
CTGGCTGGGGTTCAGGCGACGGTTGAGAATCCAACGACGGCTGAGGTTCCGGGGACGGATGAGGCCTCGAAGCCG
GTTGATGAGAATCCGGCGACGGCTGAGAATTCGACGACAACAGAGCCCGCCGAGCCCGCCGAGCCCGCTATGCCC
GCCGATTGGGACAGACGGTACGATTTCATAGAACTGGAAGAGCTTGACGAGCCCATGGGGCAGAGACGAGGATAC
AATTACGGACAGCACCAAGGGCATAGGACGCCGTTGTACGACTTTCACATCCGGCACGAAGCTGACCTGGTCGCC
TACGCAAACCACAAGCTGCCGATCATGTACCCGAAGTATGGCACCATCACACAATCGCACTTCACCACCCGCATC
AATGCCTCCTTCTGGGACGTCAGCCACATGGTGCAACACATAGTCCAGGGCGACGAGGCGGCCAAGTGTCTCGAG
CTCTTGACGCCGGGGGCGTGGCGGACGGCGCCGTTGATGAGGGCCAAGTTGACGACGTTTCTCTGGCCTACTGGC
GGCATCGTCGATGATGCCGTCGTCACCAAGTTGGCCGAGGATAAGTTCTACATCGTCACCAACGGGGCGACTCGC
GAGAAGATCATGGAATACTTGAGGGAGCAGCTTGCGGACGTGCGCAAATCCGAGAAGGAGGGTGACGGGGGGCTC
GATTGGACAATAGCGGACAGAAAGGCGCTGCTGGCGCTGCAGGGTCCGGATTCTCAGAGCATCATAAGCAATCTT
CTCCCCGAGGACGAGACGCGGGTCGACCTCGACAAGCTTTACTTTGGCGATGCCTTTTTCAGCAAGCTACATATC
GAGAATGATGTGAGGACGCCGTACGACATCCTCATCACGCGGGGAGGCTACACGGGCGAGGACGGCTTCGAGCTC
TCGTTTGCCTTTGGCAATGATGAGGCCAGAAATATCGGCTACAACGTGGCCGGTCGGGTGGCCGACTCTTTGATG
AGGTCGGACCCGGACGGGATGGTGCTGCCGTCGGGGCTCGGCACGCGCGACACGCTGCGGCTCGAGGCCGGTCTC
TGTCTGTACGGCCAAGATCTCGACGACAAGACGACGCCGGTCGAGGCCGGACTCGGCTGGGTCGTTTCTCCCGAG
AGGCGGGTTTCGGGCGGCTTTCTCGGCGCCGACGTCATCATCCCTCAACTGACACCCAAGAGCAAAGGCGGCGCG
GGCGTTTGGCGGAGGCGCATCGGCATGGTTGCCGAGTCTGGGCGACCGGCGCGGCATGGAGCCAAGATCTATCAC
AAGGGGCGGGAGGTTGGCGCCGTGACGAGCGGGATCCCCAGCCCGTCGCTGCAGGTGAATATCGCCATGGGATAT
GTCGAGGACGGGCTGCACAAGGTTGGCACCGAGCTCGAGGTCGACGTCCGCAAGAGGATGGAGAAGGTGACGGTT
GTCAAGATGCCGTTTATCGAAACGCGGTATCGTAGGCCTGATGGGGATAGGCAGCCGGGTAGCGTACCCTGGGCA
GAGCCGCAGACTCCCGAATGA
Gene >Ophun1|3218
ATGCGGACTGGAATCAGGAGCCTTGTGCGCGCGGCTGTTCGGCTGCCGCGGGCGCCGGCGGCGCGCTTTTCGGTG
ACGGCGAGGGTTTTGACGGATGGGGAGTCGAAGGTGAAGGGGGGGGAGGCTTTGAAGGTGAACGGGGGTTCGAAG
CTGGCTGGGGTTCAGGCGACGGTTGAGAATCCAACGACGGCTGAGGTTCCGGGGACGGATGAGGCCTCGAAGCCG
GTTGATGAGAATCCGGCGACGGCTGAGAATTCGACGACAACAGAGCCCGCCGAGCCCGCCGAGCCCGCTATGCCC
GCCGATTGGGACAGACGGTACGATTTCATAGAACTGGAAGAGCTTGACGAGCCCATGGGGCAGAGACGAGGATAC
AATTACGGACAGCACCAAGGGCATAGGACGCCGTTGTACGACTTTCACATCCGGCACGAAGCTGACCTGGTCGCC
TACGCAAACCACAAGCTGCCGATCATGTACCCGAAGTATGGCACCATCACACAATCGCACTTCACCACCCGCATC
AATGCCTCCTTCTGGGACGTCAGCCACATGGTGCAACACATAGTCCAGGGCGACGAGGCGGCCAAGTGTCTCGAG
CTCTTGACGCCGGGGGCGTGGCGGACGGCGCCGTTGATGAGGGCCAAGTTGACGACGTTTCTCTGGCCTACTGGC
GGCATCGTCGATGATGCCGTCGTCACCAAGTTGGCCGAGGATAAGTTCTACATCGTCACCAACGGGGCGACTCGC
GAGAAGATCATGGAATACTTGAGGGAGCAGCTTGCGGACGTGCGCAAATCCGAGAAGGAGGGTGACGGGGGGCTC
GATTGGACAATAGCGGACAGAAAGGCGCTGCTGGCGCTGCAGGGTCCGGATTCTCAGAGCATCATAAGCAATCTT
CTCCCCGAGGACGAGACGCGGGTCGACCTCGACAAGCTTTACTTTGGCGATGCCTTTTTCAGCAAGCTACATATC
GAGAATGATGTGAGGACGCCGTACGACATCCTCATCACGCGGGGAGGCTACACGGGCGAGGACGGCTTCGAGCTC
TCGTTTGCCTTTGGCAATGATGAGGCCAGAAATATCGGCTACAACGTGGCCGGTCGGGTGGCCGACTCTTTGATG
AGGTCGGACCCGGACGGGATGGTGCTGCCGTCGGGGCTCGGCACGCGCGACACGCTGCGGCTCGAGGCCGGTCTC
TGTCTGTACGGCCAAGATCTCGACGACAAGACGACGCCGGTCGAGGCCGGACTCGGCTGGGTCGTTTCTCCCGAG
AGGCGGGTTTCGGGCGGCTTTCTCGGCGCCGACGTCATCATCCCTCAACTGACACCCAAGAGCAAAGGCGGCGCG
GGCGTTTGGCGGAGGCGCATCGGCATGGTTGCCGAGTCTGGGCGACCGGCGCGGCATGGAGCCAAGATCTATCAC
AAGGGGCGGGAGGTTGGCGCCGTGACGAGCGGGATCCCCAGCCCGTCGCTGCAGGTGAATATCGCCATGGGATAT
GTCGAGGACGGGCTGCACAAGGTTGGCACCGAGCTCGAGGTCGACGTCCGCAAGAGGATGGAGAAGGTGACGGTT
GTCAAGATGCCGTTTATCGAAACGCGGTATCGTAGGCCTGATGGGGATAGGCAGCCGGGTAGCGTACCCTGGGCA
GAGCCGCAGACTCCCGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail