Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3213
Gene name
LocationContig_286:6995..10595
Strand+
Gene length (bp)3600
Transcript length (bp)3537
Coding sequence length (bp)3537
Protein length (aa) 1179

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11715 Nup160 Nucleoporin Nup120/160 2.8E-142 29 571

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0E7|NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP120 PE=3 SV=1 7 1133 0.0E+00
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 48 558 5.0E-15
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 778 1161 1.0E-12
sp|Q9VKJ3|NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster GN=Nup160 PE=1 SV=1 252 1151 3.0E-12
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 253 581 9.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S0E7|NU120_CHATD Nucleoporin NUP120 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP120 PE=3 SV=1 7 1133 0.0E+00
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 48 558 5.0E-15
sp|O43044|NU120_SCHPO Nucleoporin nup120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup120 PE=1 SV=1 778 1161 1.0E-12
sp|Q9VKJ3|NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster GN=Nup160 PE=1 SV=1 252 1151 3.0E-12
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 253 581 9.0E-11
sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 268 581 5.0E-10
sp|Q9Z0W3|NU160_MOUSE Nuclear pore complex protein Nup160 OS=Mus musculus GN=Nup160 PE=1 SV=2 852 1130 1.0E-09
sp|Q12769|NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 852 1130 1.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1997
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6492
Ophiocordyceps australis map64 (Brazil) OphauB2|7803
Ophiocordyceps camponoti-floridani Ophcf2|07377
Ophiocordyceps camponoti-rufipedis Ophun1|3213 (this protein)
Ophiocordyceps kimflemingae Ophio5|5144
Ophiocordyceps subramaniannii Hirsu2|2234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3213
MEHQEAQILFKETRLNLEPPSPAVQVSIRVPSKSGGARTQQTSDSSVDDETTFRLRNLAGASSVYHRRWHDAPRS
FLWRVLDDGRLLSIRVVDLCKRDKAPDAPLVLNFTFALPIQPGCVAFSDPQEHDALCVFVLDRASQLFTFTLRPD
CFRRRAAVDASLSELGKVQTPAGLGFKTPHRLVAVTSDILLATVNDGGMIRFDRNRTDDATTGMWKESFFNVQGW
TQNLRSLLPFQSKHSIRHGKVNMEYSAATSIQVTSFGLDQSLFAVTVCLDHRMRIWNIDDGQIIYTGDILNVDRP
SNEVGKWGIDPLQSNLVYLVGRHRGQRICATYSPIGSGEFKFWKLVARDAHTVTVEDLFPENRLFPPTPSSPDIW
TMADFVLSSPSESSINLWTLWKNNMTYRLQRLELDRNNMETTWDDGWEGVCPESGPINVPVSEPCDPTDVTEKWL
RVIFSPGKYTKATLQTALSIYERGLGTSRDNSTRGRSLAESICSVLGATASLERASSGAMDYELFRSSNDTQWRR
FYRLLNELDKQRGEAIGLALDPDTDMAWVVCADLLSAVTECSSLERVFFNLSSPDEEQQDLSALIGSAVAFIDGF
SDTYLQLSKAVANREIFEQSSKTDMERISYFSDKAAFWRGITDDDCAQVVEALGANFEIVTDDLYRQVMRLMAAP
LEAKRRHLRHPLTEFGKKLIMKGVQNCINLQFHVCFSQLVLLVHMEFEYDKEEEALHHRVDIGPIFRQLVDTLRR
LALLEWLARTELSVPLFRSEKGAPAPVLRKSDGGDESQVITALEANVGHLLGFGHARSEALSLTITELVSNLCAP
DSDIEVSPTLIQCSLLKRDRADLALELAPFCDQNPFSYYINGRVLLALKDLEAAAINFRKAAVGMGEENTQCSAD
ELMKADSEAGDDLIRSGRHSCGLLDDTEWNLLNNGPVKYYAHITALYEEQRAYSYVMEHARLAIQFAGFTQGTDD
VKMDMLSRLFHAALATSQFELAHTSLFSMKDEALRHSSLRLLVDKMCETYHSTELVKLPFPGMQQEVDAILAQRC
KKTADVVHGFPYHQVLYSWRIRRNNYRGAASVLLDLIQKLRQAGEGDRMTGDDVLDTPVTRQYLLLINALSCVDA
KQAWVFDEGVAGRKRHVVSLADIRKQYRDELDRIAAIQNNQFGFEAGDDMELA*
Coding >Ophun1|3213
ATGGAGCATCAAGAAGCGCAGATTCTCTTCAAGGAGACCCGCCTCAATCTCGAACCGCCCTCGCCTGCCGTCCAA
GTCAGCATCCGCGTCCCTTCCAAGTCGGGCGGCGCCCGCACTCAGCAGACAAGCGACTCGTCCGTCGACGACGAG
ACGACGTTCCGGCTGAGGAACCTAGCTGGCGCCTCGTCTGTCTACCATCGCAGGTGGCATGACGCGCCGCGCAGC
TTCCTTTGGCGCGTCCTCGACGATGGCCGCTTGCTGAGCATTCGAGTCGTTGATCTCTGCAAGCGCGACAAGGCG
CCCGACGCGCCGCTCGTGCTCAACTTCACCTTTGCTCTTCCTATACAGCCCGGGTGCGTGGCTTTTTCCGACCCG
CAGGAGCACGATGCGCTGTGCGTCTTCGTCTTGGATCGGGCCTCGCAGCTCTTCACCTTTACCCTGCGACCCGAC
TGCTTCAGACGCCGGGCGGCTGTCGACGCCAGCTTGTCAGAGCTGGGCAAGGTTCAGACGCCGGCGGGCTTGGGC
TTCAAGACACCGCATCGACTGGTCGCTGTCACGTCTGACATTTTACTGGCGACTGTCAACGATGGCGGCATGATC
CGCTTCGATAGGAACAGGACAGACGATGCGACGACGGGCATGTGGAAGGAGTCATTCTTCAACGTTCAGGGCTGG
ACCCAAAACCTTCGGAGCCTGCTGCCGTTCCAGAGCAAGCACAGCATCAGGCACGGAAAGGTCAACATGGAGTAT
TCGGCGGCCACGTCCATCCAGGTGACGTCGTTCGGCCTCGATCAAAGCCTCTTTGCCGTCACCGTCTGTCTCGAT
CATCGCATGCGCATCTGGAATATCGACGATGGCCAAATCATCTACACCGGCGACATCCTCAACGTCGACAGGCCG
TCCAACGAGGTGGGCAAATGGGGAATCGATCCTCTGCAGTCTAATCTCGTCTACCTCGTTGGAAGGCACCGGGGC
CAGAGAATATGCGCCACCTACTCGCCCATCGGGTCCGGCGAGTTCAAGTTCTGGAAACTGGTCGCCAGGGACGCC
CATACCGTGACGGTTGAAGATCTCTTCCCCGAGAACCGCCTCTTTCCGCCGACTCCCTCCTCTCCCGACATATGG
ACCATGGCTGACTTCGTGCTGTCGTCTCCGTCTGAGAGCTCCATCAACCTCTGGACCCTTTGGAAGAACAACATG
ACATACAGACTGCAGCGCCTCGAGCTCGACAGGAACAACATGGAGACTACGTGGGACGACGGCTGGGAGGGTGTT
TGTCCCGAGTCGGGACCCATCAACGTCCCCGTCTCAGAACCCTGTGACCCTACCGACGTGACCGAGAAGTGGCTA
CGCGTCATCTTCTCACCCGGCAAGTATACCAAGGCAACGCTACAGACGGCCCTATCAATCTACGAGCGCGGCTTG
GGGACAAGTCGGGACAATAGTACGCGTGGGAGGAGCCTGGCCGAGTCCATCTGCTCCGTTCTCGGCGCTACGGCT
TCCCTGGAGCGAGCATCTTCCGGCGCCATGGACTATGAGCTTTTCCGGTCTTCGAACGACACCCAGTGGCGAAGA
TTCTATCGGCTACTCAACGAGCTGGATAAGCAGCGCGGCGAAGCCATTGGCCTTGCTCTGGACCCGGATACGGAC
ATGGCTTGGGTCGTCTGTGCGGATCTTCTCTCGGCCGTCACAGAGTGCAGCAGCCTGGAGCGAGTCTTCTTCAAC
CTATCCTCACCGGACGAAGAGCAGCAGGACCTTTCTGCCCTGATCGGCTCTGCCGTAGCCTTCATCGACGGCTTC
TCCGACACATATCTGCAGCTCTCCAAGGCCGTCGCCAACCGAGAGATCTTCGAGCAGTCCTCCAAGACGGATATG
GAGCGCATCTCCTACTTTTCCGACAAGGCTGCCTTTTGGCGCGGCATCACCGATGACGACTGCGCCCAGGTAGTC
GAAGCTCTGGGTGCCAACTTTGAGATTGTCACCGACGACCTTTACAGACAGGTTATGCGCCTGATGGCCGCGCCG
CTCGAAGCGAAGCGTCGCCACCTTCGCCATCCCCTGACCGAGTTTGGCAAGAAGCTCATCATGAAGGGCGTCCAA
AACTGTATCAACCTCCAGTTCCACGTCTGCTTCTCTCAGCTTGTGCTTCTGGTGCACATGGAGTTTGAGTACGAC
AAGGAGGAGGAGGCTCTCCACCACCGAGTCGACATCGGGCCCATCTTTCGCCAGCTCGTCGACACGCTCAGGAGG
CTCGCCTTGCTGGAATGGCTCGCGCGGACGGAGCTGTCGGTGCCTCTCTTCCGGTCGGAAAAGGGGGCGCCGGCG
CCGGTTCTGAGGAAGAGCGACGGCGGCGACGAGTCGCAAGTCATCACGGCTCTCGAGGCCAATGTCGGCCATCTA
CTGGGCTTCGGCCATGCTCGGAGCGAGGCTCTTTCGCTGACCATCACGGAGCTGGTGTCGAACCTCTGCGCGCCC
GACAGCGATATCGAGGTGTCTCCGACGCTGATCCAGTGCTCGCTCCTTAAGCGCGATAGAGCGGATCTGGCCCTG
GAGCTGGCACCCTTTTGCGACCAGAATCCCTTCTCCTATTATATCAATGGTCGAGTGCTTCTGGCGCTCAAAGAC
CTGGAAGCGGCCGCCATCAACTTCAGGAAGGCTGCTGTCGGAATGGGTGAGGAGAACACGCAGTGCTCCGCGGAC
GAACTCATGAAAGCTGACTCTGAGGCAGGCGACGACTTGATCAGGTCGGGCCGGCATAGCTGCGGCCTGCTCGAC
GATACGGAATGGAACCTGCTGAACAACGGTCCGGTCAAATATTACGCTCACATCACCGCGCTGTACGAGGAGCAG
AGAGCCTACTCGTACGTCATGGAGCATGCCAGGCTGGCCATCCAGTTCGCGGGCTTCACTCAGGGCACCGACGAC
GTCAAGATGGACATGCTGAGCCGGCTGTTCCACGCGGCCTTGGCCACGTCGCAGTTCGAGCTTGCCCATACGAGC
CTGTTCTCGATGAAAGACGAGGCCTTGCGTCATTCGAGCCTGCGGCTACTCGTCGATAAGATGTGCGAGACGTAT
CACAGCACCGAACTCGTCAAGCTACCCTTCCCTGGCATGCAGCAGGAGGTGGACGCAATACTGGCTCAGCGGTGC
AAGAAGACGGCAGACGTGGTGCACGGGTTCCCCTACCACCAGGTGCTCTACTCGTGGCGGATCAGGCGCAACAAC
TACAGGGGCGCGGCGTCGGTGCTACTGGATCTCATCCAGAAGCTGAGGCAGGCAGGGGAGGGGGACCGGATGACG
GGAGACGACGTGCTCGACACGCCCGTGACGCGGCAATATTTGCTTCTCATCAACGCGCTGAGCTGCGTCGATGCG
AAGCAGGCCTGGGTCTTTGACGAGGGAGTGGCAGGCAGGAAGCGCCATGTCGTCTCCCTGGCGGACATCAGGAAG
CAGTATCGGGACGAGCTGGACAGGATCGCGGCCATTCAGAACAACCAGTTTGGGTTCGAGGCGGGCGATGACATG
GAACTCGCGTGA
Transcript >Ophun1|3213
ATGGAGCATCAAGAAGCGCAGATTCTCTTCAAGGAGACCCGCCTCAATCTCGAACCGCCCTCGCCTGCCGTCCAA
GTCAGCATCCGCGTCCCTTCCAAGTCGGGCGGCGCCCGCACTCAGCAGACAAGCGACTCGTCCGTCGACGACGAG
ACGACGTTCCGGCTGAGGAACCTAGCTGGCGCCTCGTCTGTCTACCATCGCAGGTGGCATGACGCGCCGCGCAGC
TTCCTTTGGCGCGTCCTCGACGATGGCCGCTTGCTGAGCATTCGAGTCGTTGATCTCTGCAAGCGCGACAAGGCG
CCCGACGCGCCGCTCGTGCTCAACTTCACCTTTGCTCTTCCTATACAGCCCGGGTGCGTGGCTTTTTCCGACCCG
CAGGAGCACGATGCGCTGTGCGTCTTCGTCTTGGATCGGGCCTCGCAGCTCTTCACCTTTACCCTGCGACCCGAC
TGCTTCAGACGCCGGGCGGCTGTCGACGCCAGCTTGTCAGAGCTGGGCAAGGTTCAGACGCCGGCGGGCTTGGGC
TTCAAGACACCGCATCGACTGGTCGCTGTCACGTCTGACATTTTACTGGCGACTGTCAACGATGGCGGCATGATC
CGCTTCGATAGGAACAGGACAGACGATGCGACGACGGGCATGTGGAAGGAGTCATTCTTCAACGTTCAGGGCTGG
ACCCAAAACCTTCGGAGCCTGCTGCCGTTCCAGAGCAAGCACAGCATCAGGCACGGAAAGGTCAACATGGAGTAT
TCGGCGGCCACGTCCATCCAGGTGACGTCGTTCGGCCTCGATCAAAGCCTCTTTGCCGTCACCGTCTGTCTCGAT
CATCGCATGCGCATCTGGAATATCGACGATGGCCAAATCATCTACACCGGCGACATCCTCAACGTCGACAGGCCG
TCCAACGAGGTGGGCAAATGGGGAATCGATCCTCTGCAGTCTAATCTCGTCTACCTCGTTGGAAGGCACCGGGGC
CAGAGAATATGCGCCACCTACTCGCCCATCGGGTCCGGCGAGTTCAAGTTCTGGAAACTGGTCGCCAGGGACGCC
CATACCGTGACGGTTGAAGATCTCTTCCCCGAGAACCGCCTCTTTCCGCCGACTCCCTCCTCTCCCGACATATGG
ACCATGGCTGACTTCGTGCTGTCGTCTCCGTCTGAGAGCTCCATCAACCTCTGGACCCTTTGGAAGAACAACATG
ACATACAGACTGCAGCGCCTCGAGCTCGACAGGAACAACATGGAGACTACGTGGGACGACGGCTGGGAGGGTGTT
TGTCCCGAGTCGGGACCCATCAACGTCCCCGTCTCAGAACCCTGTGACCCTACCGACGTGACCGAGAAGTGGCTA
CGCGTCATCTTCTCACCCGGCAAGTATACCAAGGCAACGCTACAGACGGCCCTATCAATCTACGAGCGCGGCTTG
GGGACAAGTCGGGACAATAGTACGCGTGGGAGGAGCCTGGCCGAGTCCATCTGCTCCGTTCTCGGCGCTACGGCT
TCCCTGGAGCGAGCATCTTCCGGCGCCATGGACTATGAGCTTTTCCGGTCTTCGAACGACACCCAGTGGCGAAGA
TTCTATCGGCTACTCAACGAGCTGGATAAGCAGCGCGGCGAAGCCATTGGCCTTGCTCTGGACCCGGATACGGAC
ATGGCTTGGGTCGTCTGTGCGGATCTTCTCTCGGCCGTCACAGAGTGCAGCAGCCTGGAGCGAGTCTTCTTCAAC
CTATCCTCACCGGACGAAGAGCAGCAGGACCTTTCTGCCCTGATCGGCTCTGCCGTAGCCTTCATCGACGGCTTC
TCCGACACATATCTGCAGCTCTCCAAGGCCGTCGCCAACCGAGAGATCTTCGAGCAGTCCTCCAAGACGGATATG
GAGCGCATCTCCTACTTTTCCGACAAGGCTGCCTTTTGGCGCGGCATCACCGATGACGACTGCGCCCAGGTAGTC
GAAGCTCTGGGTGCCAACTTTGAGATTGTCACCGACGACCTTTACAGACAGGTTATGCGCCTGATGGCCGCGCCG
CTCGAAGCGAAGCGTCGCCACCTTCGCCATCCCCTGACCGAGTTTGGCAAGAAGCTCATCATGAAGGGCGTCCAA
AACTGTATCAACCTCCAGTTCCACGTCTGCTTCTCTCAGCTTGTGCTTCTGGTGCACATGGAGTTTGAGTACGAC
AAGGAGGAGGAGGCTCTCCACCACCGAGTCGACATCGGGCCCATCTTTCGCCAGCTCGTCGACACGCTCAGGAGG
CTCGCCTTGCTGGAATGGCTCGCGCGGACGGAGCTGTCGGTGCCTCTCTTCCGGTCGGAAAAGGGGGCGCCGGCG
CCGGTTCTGAGGAAGAGCGACGGCGGCGACGAGTCGCAAGTCATCACGGCTCTCGAGGCCAATGTCGGCCATCTA
CTGGGCTTCGGCCATGCTCGGAGCGAGGCTCTTTCGCTGACCATCACGGAGCTGGTGTCGAACCTCTGCGCGCCC
GACAGCGATATCGAGGTGTCTCCGACGCTGATCCAGTGCTCGCTCCTTAAGCGCGATAGAGCGGATCTGGCCCTG
GAGCTGGCACCCTTTTGCGACCAGAATCCCTTCTCCTATTATATCAATGGTCGAGTGCTTCTGGCGCTCAAAGAC
CTGGAAGCGGCCGCCATCAACTTCAGGAAGGCTGCTGTCGGAATGGGTGAGGAGAACACGCAGTGCTCCGCGGAC
GAACTCATGAAAGCTGACTCTGAGGCAGGCGACGACTTGATCAGGTCGGGCCGGCATAGCTGCGGCCTGCTCGAC
GATACGGAATGGAACCTGCTGAACAACGGTCCGGTCAAATATTACGCTCACATCACCGCGCTGTACGAGGAGCAG
AGAGCCTACTCGTACGTCATGGAGCATGCCAGGCTGGCCATCCAGTTCGCGGGCTTCACTCAGGGCACCGACGAC
GTCAAGATGGACATGCTGAGCCGGCTGTTCCACGCGGCCTTGGCCACGTCGCAGTTCGAGCTTGCCCATACGAGC
CTGTTCTCGATGAAAGACGAGGCCTTGCGTCATTCGAGCCTGCGGCTACTCGTCGATAAGATGTGCGAGACGTAT
CACAGCACCGAACTCGTCAAGCTACCCTTCCCTGGCATGCAGCAGGAGGTGGACGCAATACTGGCTCAGCGGTGC
AAGAAGACGGCAGACGTGGTGCACGGGTTCCCCTACCACCAGGTGCTCTACTCGTGGCGGATCAGGCGCAACAAC
TACAGGGGCGCGGCGTCGGTGCTACTGGATCTCATCCAGAAGCTGAGGCAGGCAGGGGAGGGGGACCGGATGACG
GGAGACGACGTGCTCGACACGCCCGTGACGCGGCAATATTTGCTTCTCATCAACGCGCTGAGCTGCGTCGATGCG
AAGCAGGCCTGGGTCTTTGACGAGGGAGTGGCAGGCAGGAAGCGCCATGTCGTCTCCCTGGCGGACATCAGGAAG
CAGTATCGGGACGAGCTGGACAGGATCGCGGCCATTCAGAACAACCAGTTTGGGTTCGAGGCGGGCGATGACATG
GAACTCGCGTGA
Gene >Ophun1|3213
ATGGAGCATCAAGAAGCGCAGATTCTCTTCAAGGAGACCCGCCTCAATCTCGAACCGCCCTCGCCTGCCGTCCAA
GTCAGCATCCGCGTCCCTTCCAAGTCGGGCGGCGCCCGCACTCAGCAGACAAGCGACTCGTCCGTCGACGACGAG
ACGACGTTCCGGCTGAGGAACCTAGCTGGCGCCTCGTCTGTCTACCATCGCAGGTGGCATGACGCGCCGCGCAGC
TTCCTTTGGCGCGTCCTCGACGATGGCCGCTTGCTGAGCATTCGAGTCGTTGATCTCTGCAAGCGCGACAAGGCG
CCCGACGCGCCGCTCGTGCTCAACTTCACCTTTGCTCTTCCTATACAGCCCGGGTGCGTGGCTTTTTCCGACCCG
CAGGAGCACGATGCGCTGTGCGTCTTCGTCTTGGATCGGGCCTCGCAGCTCTTCACCTTTACCCTGCGACCCGAC
TGCTTCAGACGCCGGGCGGCTGTCGACGCCAGCTTGTCAGAGCTGGGCAAGGTTCAGACGCCGGCGGGCTTGGGC
TTCAAGACACCGCATCGACTGGTCGCTGTCACGTCTGACATTTTACTGGCGACTGTCAACGATGGCGGCATGATC
CGCTTCGATAGGAACAGGACAGACGATGGTAAAGCTCCCTCTCTTTCTTCCCCAACTGCGCGGCGAGAACGACAA
TTGACCAGCTCTTCAGCGACGACGGGCATGTGGAAGGAGTCATTCTTCAACGTTCAGGGCTGGACCCAAAACCTT
CGGAGCCTGCTGCCGTTCCAGAGCAAGCACAGCATCAGGCACGGAAAGGTCAACATGGAGTATTCGGCGGCCACG
TCCATCCAGGTGACGTCGTTCGGCCTCGATCAAAGCCTCTTTGCCGTCACCGTCTGTCTCGATCATCGCATGCGC
ATCTGGAATATCGACGATGGCCAAATCATCTACACCGGCGACATCCTCAACGTCGACAGGCCGTCCAACGAGGTG
GGCAAATGGGGAATCGATCCTCTGCAGTCTAATCTCGTCTACCTCGTTGGAAGGCACCGGGGCCAGAGAATATGC
GCCACCTACTCGCCCATCGGGTCCGGCGAGTTCAAGTTCTGGAAACTGGTCGCCAGGGACGCCCATACCGTGACG
GTTGAAGATCTCTTCCCCGAGAACCGCCTCTTTCCGCCGACTCCCTCCTCTCCCGACATATGGACCATGGCTGAC
TTCGTGCTGTCGTCTCCGTCTGAGAGCTCCATCAACCTCTGGACCCTTTGGAAGAACAACATGACATACAGACTG
CAGCGCCTCGAGCTCGACAGGAACAACATGGAGACTACGTGGGACGACGGCTGGGAGGGTGTTTGTCCCGAGTCG
GGACCCATCAACGTCCCCGTCTCAGAACCCTGTGACCCTACCGACGTGACCGAGAAGTGGCTACGCGTCATCTTC
TCACCCGGCAAGTATACCAAGGCAACGCTACAGACGGCCCTATCAATCTACGAGCGCGGCTTGGGGACAAGTCGG
GACAATAGTACGCGTGGGAGGAGCCTGGCCGAGTCCATCTGCTCCGTTCTCGGCGCTACGGCTTCCCTGGAGCGA
GCATCTTCCGGCGCCATGGACTATGAGCTTTTCCGGTCTTCGAACGACACCCAGTGGCGAAGATTCTATCGGCTA
CTCAACGAGCTGGATAAGCAGCGCGGCGAAGCCATTGGCCTTGCTCTGGACCCGGATACGGACATGGCTTGGGTC
GTCTGTGCGGATCTTCTCTCGGCCGTCACAGAGTGCAGCAGCCTGGAGCGAGTCTTCTTCAACCTATCCTCACCG
GACGAAGAGCAGCAGGACCTTTCTGCCCTGATCGGCTCTGCCGTAGCCTTCATCGACGGCTTCTCCGACACATAT
CTGCAGCTCTCCAAGGCCGTCGCCAACCGAGAGATCTTCGAGCAGTCCTCCAAGACGGATATGGAGCGCATCTCC
TACTTTTCCGACAAGGCTGCCTTTTGGCGCGGCATCACCGATGACGACTGCGCCCAGGTAGTCGAAGCTCTGGGT
GCCAACTTTGAGATTGTCACCGACGACCTTTACAGACAGGTTATGCGCCTGATGGCCGCGCCGCTCGAAGCGAAG
CGTCGCCACCTTCGCCATCCCCTGACCGAGTTTGGCAAGAAGCTCATCATGAAGGGCGTCCAAAACTGTATCAAC
CTCCAGTTCCACGTCTGCTTCTCTCAGCTTGTGCTTCTGGTGCACATGGAGTTTGAGTACGACAAGGAGGAGGAG
GCTCTCCACCACCGAGTCGACATCGGGCCCATCTTTCGCCAGCTCGTCGACACGCTCAGGAGGCTCGCCTTGCTG
GAATGGCTCGCGCGGACGGAGCTGTCGGTGCCTCTCTTCCGGTCGGAAAAGGGGGCGCCGGCGCCGGTTCTGAGG
AAGAGCGACGGCGGCGACGAGTCGCAAGTCATCACGGCTCTCGAGGCCAATGTCGGCCATCTACTGGGCTTCGGC
CATGCTCGGAGCGAGGCTCTTTCGCTGACCATCACGGAGCTGGTGTCGAACCTCTGCGCGCCCGACAGCGATATC
GAGGTGTCTCCGACGCTGATCCAGTGCTCGCTCCTTAAGCGCGATAGAGCGGATCTGGCCCTGGAGCTGGCACCC
TTTTGCGACCAGAATCCCTTCTCCTATTATATCAATGGTCGAGTGCTTCTGGCGCTCAAAGACCTGGAAGCGGCC
GCCATCAACTTCAGGAAGGCTGCTGTCGGAATGGGTGAGGAGAACACGCAGTGCTCCGCGGACGAACTCATGAAA
GCTGACTCTGAGGCAGGCGACGACTTGATCAGGTCGGGCCGGCATAGCTGCGGCCTGCTCGACGATACGGAATGG
AACCTGCTGAACAACGGTCCGGTCAAATATTACGCTCACATCACCGCGCTGTACGAGGAGCAGAGAGCCTACTCG
TACGTCATGGAGCATGCCAGGCTGGCCATCCAGTTCGCGGGCTTCACTCAGGGCACCGACGACGTCAAGATGGAC
ATGCTGAGCCGGCTGTTCCACGCGGCCTTGGCCACGTCGCAGTTCGAGCTTGCCCATACGAGCCTGTTCTCGATG
AAAGACGAGGCCTTGCGTCATTCGAGCCTGCGGCTACTCGTCGATAAGATGTGCGAGACGTATCACAGCACCGAA
CTCGTCAAGCTACCCTTCCCTGGCATGCAGCAGGAGGTGGACGCAATACTGGCTCAGCGGTGCAAGAAGACGGCA
GACGTGGTGCACGGGTTCCCCTACCACCAGGTGCTCTACTCGTGGCGGATCAGGCGCAACAACTACAGGGGCGCG
GCGTCGGTGCTACTGGATCTCATCCAGAAGCTGAGGCAGGCAGGGGAGGGGGACCGGATGACGGGAGACGACGTG
CTCGACACGCCCGTGACGCGGCAATATTTGCTTCTCATCAACGCGCTGAGCTGCGTCGATGCGAAGCAGGCCTGG
GTCTTTGACGAGGGAGTGGCAGGCAGGAAGCGCCATGTCGTCTCCCTGGCGGACATCAGGAAGCAGTATCGGGAC
GAGCTGGACAGGATCGCGGCCATTCAGAACAACCAGTTTGGGTTCGAGGCGGGCGATGACATGGAACTCGCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail