Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3208
Gene name
LocationContig_285:20058..21126
Strand+
Gene length (bp)1068
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase 6.9E-19 221 315

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8X0|TRM10_GIBZE tRNA (guanine(9)-N1)-methyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TRM10 PE=3 SV=1 8 319 2.0E-107
sp|Q4WXA1|TRM10_ASPFU tRNA (guanine(9)-N1)-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=trm10 PE=3 SV=1 17 327 2.0E-81
sp|Q5B8X0|TRM10_EMENI tRNA (guanine(9)-N1)-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trm10 PE=3 SV=1 23 330 2.0E-71
sp|O14214|TRM10_SCHPO tRNA (guanine(9)-N1)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm10 PE=1 SV=1 11 324 1.0E-49
sp|Q6C1W9|TRM10_YARLI tRNA (guanine(9)-N1)-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM10 PE=3 SV=1 13 315 7.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I8X0|TRM10_GIBZE tRNA (guanine(9)-N1)-methyltransferase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TRM10 PE=3 SV=1 8 319 2.0E-107
sp|Q4WXA1|TRM10_ASPFU tRNA (guanine(9)-N1)-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=trm10 PE=3 SV=1 17 327 2.0E-81
sp|Q5B8X0|TRM10_EMENI tRNA (guanine(9)-N1)-methyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=trm10 PE=3 SV=1 23 330 2.0E-71
sp|O14214|TRM10_SCHPO tRNA (guanine(9)-N1)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm10 PE=1 SV=1 11 324 1.0E-49
sp|Q6C1W9|TRM10_YARLI tRNA (guanine(9)-N1)-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRM10 PE=3 SV=1 13 315 7.0E-45
sp|Q6CUM6|TRM10_KLULA tRNA (guanine(9)-N1)-methyltransferase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRM10 PE=3 SV=1 18 315 1.0E-42
sp|Q12400|TRM10_YEAST tRNA (guanine(9)-N1)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM10 PE=1 SV=1 22 315 7.0E-42
sp|Q59Q39|TRM10_CANAL tRNA (guanine(9)-N1)-methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TRM10 PE=3 SV=1 28 315 1.0E-40
sp|Q6FQB2|TRM10_CANGA tRNA (guanine(9)-N1)-methyltransferase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRM10 PE=3 SV=1 19 315 4.0E-40
sp|Q75A17|TRM10_ASHGO tRNA (guanine(9)-N1)-methyltransferase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRM10 PE=3 SV=1 49 333 7.0E-40
sp|Q6BWG3|TRM10_DEBHA tRNA (guanine(9)-N1)-methyltransferase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRM10 PE=3 SV=2 28 315 8.0E-37
sp|Q4KLI2|TM10A_RAT tRNA methyltransferase 10 homolog A OS=Rattus norvegicus GN=Trmt10a PE=1 SV=1 24 318 2.0E-36
sp|Q3MHI8|TM10A_BOVIN tRNA methyltransferase 10 homolog A OS=Bos taurus GN=TRMT10A PE=2 SV=1 26 317 3.0E-35
sp|Q66JJ4|TM10A_XENTR tRNA methyltransferase 10 homolog A OS=Xenopus tropicalis GN=trmt10a PE=2 SV=1 28 317 6.0E-35
sp|Q8C1Z8|TM10A_MOUSE tRNA methyltransferase 10 homolog A OS=Mus musculus GN=Trmt10a PE=2 SV=2 25 318 6.0E-34
sp|Q8TBZ6|TM10A_HUMAN tRNA methyltransferase 10 homolog A OS=Homo sapiens GN=TRMT10A PE=1 SV=1 26 318 2.0E-32
sp|P0CS10|TRM10_CRYNJ tRNA (guanine(9)-N1)-methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TRM10 PE=3 SV=1 90 315 3.0E-27
sp|P0CS11|TRM10_CRYNB tRNA (guanine(9)-N1)-methyltransferase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TRM10 PE=3 SV=1 90 315 1.0E-26
sp|Q9VR56|TM10A_DROME tRNA methyltransferase 10 homolog A OS=Drosophila melanogaster GN=trmt10a PE=2 SV=1 219 342 1.0E-24
sp|Q08BM0|TM10B_DANRE tRNA methyltransferase 10 homolog B OS=Danio rerio GN=trmt10b PE=2 SV=1 1 319 2.0E-22
sp|Q9D075|TM10B_MOUSE tRNA methyltransferase 10 homolog B OS=Mus musculus GN=Trmt10b PE=2 SV=2 22 319 1.0E-18
sp|Q08DP1|TM10B_BOVIN tRNA methyltransferase 10 homolog B OS=Bos taurus GN=TRMT10B PE=2 SV=1 37 319 2.0E-17
sp|Q6PF06|TM10B_HUMAN tRNA methyltransferase 10 homolog B OS=Homo sapiens GN=TRMT10B PE=2 SV=1 37 319 2.0E-17
sp|Q5RJK3|TM10B_RAT tRNA methyltransferase 10 homolog B OS=Rattus norvegicus GN=Trmt10b PE=2 SV=1 37 319 3.0E-17
sp|A4IHS0|MRRP1_XENTR Mitochondrial ribonuclease P protein 1 OS=Xenopus tropicalis GN=trmt10c PE=2 SV=1 196 315 6.0E-12
sp|Q3UFY8|MRRP1_MOUSE Mitochondrial ribonuclease P protein 1 OS=Mus musculus GN=Trmt10c PE=1 SV=2 196 327 7.0E-10
sp|Q7L0Y3|MRRP1_HUMAN Mitochondrial ribonuclease P protein 1 OS=Homo sapiens GN=TRMT10C PE=1 SV=2 91 327 2.0E-09
sp|Q5U2R4|MRRP1_RAT Mitochondrial ribonuclease P protein 1 OS=Rattus norvegicus GN=Trmt10c PE=2 SV=1 196 315 4.0E-09
sp|Q2KI45|MRRP1_BOVIN Mitochondrial ribonuclease P protein 1 OS=Bos taurus GN=TRMT10C PE=2 SV=2 196 317 1.0E-08
sp|Q7JUX9|MRRP1_DROME Mitochondrial ribonuclease P protein 1 homolog OS=Drosophila melanogaster GN=trmt10c PE=1 SV=1 221 315 3.0E-08
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5832
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7803
Ophiocordyceps australis map64 (Brazil) OphauB2|1836
Ophiocordyceps camponoti-floridani Ophcf2|03190
Ophiocordyceps camponoti-rufipedis Ophun1|3208 (this protein)
Ophiocordyceps kimflemingae Ophio5|412

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3208
MNEPPAEAQPTTTPQQHPQDPPPETQPLSKNALKRIRKQQEWEQGREDRRKRRREKRIDRRDRRRATADQDASDK
PQKPLPGSTTLEPLAIVIDCDFESYMTDKERVSLASQVTRSYSDNRRARRRAHLWVGGWRGKIRDRFRDVLGDQQ
RHWKGVGFVDGDYLACADEARRRLADQQPAAGIQGPLAEPTTAEDTAWTKDEVDPFPLPDSEPALDPAHGDVVYL
TSESPYTLRRLEPNTIYVVGGLVDRNREKGLCYRRARERGIRTARLPITDFMRMQSRRVLATNHVVEILLSWMDC
GDWGDAFLAVIPKRKGGCLIRDDEEGEPDAEAEASLVREEESTMGEVVDEACLPE*
Coding >Ophun1|3208
ATGAACGAACCCCCAGCCGAAGCCCAACCGACGACAACTCCCCAACAACACCCCCAAGATCCCCCCCCCGAAACC
CAACCCCTATCCAAGAACGCCCTCAAGCGCATCCGCAAGCAACAAGAATGGGAACAAGGCCGCGAAGACCGCCGC
AAACGCCGCCGCGAAAAGCGCATCGACCGCCGTGACCGCCGCCGCGCCACCGCAGACCAAGACGCCAGCGACAAG
CCGCAGAAGCCACTGCCAGGCAGCACCACGCTCGAACCCCTCGCCATCGTCATCGACTGCGATTTCGAGTCTTAC
ATGACGGATAAGGAGCGCGTCTCGCTCGCCTCGCAGGTCACCCGCTCCTACTCGGATAACCGGAGGGCTCGTCGT
CGTGCTCATCTGTGGGTTGGCGGTTGGCGCGGGAAGATTAGAGATCGGTTTCGGGACGTGTTGGGTGATCAGCAG
CGGCATTGGAAGGGCGTGGGCTTCGTTGACGGCGATTATCTTGCCTGTGCCGATGAAGCACGGAGACGGTTGGCG
GACCAGCAGCCCGCGGCCGGGATCCAAGGCCCTCTCGCGGAGCCGACGACGGCAGAGGATACGGCCTGGACCAAA
GACGAAGTCGATCCCTTCCCGCTACCGGACTCGGAACCGGCGCTGGACCCGGCCCACGGAGACGTCGTCTACCTG
ACATCCGAGTCTCCCTACACGCTTCGCCGACTCGAGCCCAACACCATCTACGTCGTCGGCGGGCTCGTCGACCGC
AACCGCGAAAAGGGCCTCTGCTACCGCCGCGCCCGAGAGAGGGGAATCCGGACGGCCAGGCTGCCCATCACCGAC
TTCATGCGTATGCAGAGCCGCCGCGTGCTGGCTACCAACCACGTCGTCGAGATTCTGCTTAGCTGGATGGACTGC
GGTGACTGGGGGGATGCCTTTTTGGCTGTCATTCCCAAGCGCAAGGGCGGGTGTCTCATTCGAGATGATGAGGAG
GGGGAGCCGGATGCTGAGGCTGAGGCGTCGTTGGTTCGAGAAGAGGAGTCGACGATGGGGGAGGTGGTTGACGAG
GCATGTTTACCAGAGTGA
Transcript >Ophun1|3208
ATGAACGAACCCCCAGCCGAAGCCCAACCGACGACAACTCCCCAACAACACCCCCAAGATCCCCCCCCCGAAACC
CAACCCCTATCCAAGAACGCCCTCAAGCGCATCCGCAAGCAACAAGAATGGGAACAAGGCCGCGAAGACCGCCGC
AAACGCCGCCGCGAAAAGCGCATCGACCGCCGTGACCGCCGCCGCGCCACCGCAGACCAAGACGCCAGCGACAAG
CCGCAGAAGCCACTGCCAGGCAGCACCACGCTCGAACCCCTCGCCATCGTCATCGACTGCGATTTCGAGTCTTAC
ATGACGGATAAGGAGCGCGTCTCGCTCGCCTCGCAGGTCACCCGCTCCTACTCGGATAACCGGAGGGCTCGTCGT
CGTGCTCATCTGTGGGTTGGCGGTTGGCGCGGGAAGATTAGAGATCGGTTTCGGGACGTGTTGGGTGATCAGCAG
CGGCATTGGAAGGGCGTGGGCTTCGTTGACGGCGATTATCTTGCCTGTGCCGATGAAGCACGGAGACGGTTGGCG
GACCAGCAGCCCGCGGCCGGGATCCAAGGCCCTCTCGCGGAGCCGACGACGGCAGAGGATACGGCCTGGACCAAA
GACGAAGTCGATCCCTTCCCGCTACCGGACTCGGAACCGGCGCTGGACCCGGCCCACGGAGACGTCGTCTACCTG
ACATCCGAGTCTCCCTACACGCTTCGCCGACTCGAGCCCAACACCATCTACGTCGTCGGCGGGCTCGTCGACCGC
AACCGCGAAAAGGGCCTCTGCTACCGCCGCGCCCGAGAGAGGGGAATCCGGACGGCCAGGCTGCCCATCACCGAC
TTCATGCGTATGCAGAGCCGCCGCGTGCTGGCTACCAACCACGTCGTCGAGATTCTGCTTAGCTGGATGGACTGC
GGTGACTGGGGGGATGCCTTTTTGGCTGTCATTCCCAAGCGCAAGGGCGGGTGTCTCATTCGAGATGATGAGGAG
GGGGAGCCGGATGCTGAGGCTGAGGCGTCGTTGGTTCGAGAAGAGGAGTCGACGATGGGGGAGGTGGTTGACGAG
GCATGTTTACCAGAGTGA
Gene >Ophun1|3208
ATGAACGAACCCCCAGCCGAAGCCCAACCGACGACAACTCCCCAACAACACCCCCAAGATCCCCCCCCCGAAACC
CAACCCCTATCCAAGAACGCCCTCAAGCGCATCCGCAAGCAACAAGAATGGGAACAAGGCCGCGAAGACCGCCGC
AAACGCCGCCGCGAAAAGCGCATCGACCGCCGTGACCGCCGCCGCGCCACCGCAGACCAAGACGCCAGCGACAAG
CCGCAGAAGCCACTGCCAGGCAGCACCACGCTCGAACCCCTCGCCATCGTCATCGACTGCGATTTCGAGTCTTAC
ATGACGGATAAGGAGCGCGTCTCGCTCGCCTCGCAGGTCACCCGCTCCTACTCGGATAACCGGAGGGCTCGTCGT
CGTGCTCATCTGTGGGTTGGCGGTTGGCGCGGGAAGATTAGAGATCGGTTTCGGGACGTGTTGGGTGATCAGCAG
CGGCATTGGAAGGGCGTGGGCTTCGTTGACGGCGATTATCTTGCCTGTGCCGATGAAGCACGGAGACGGTTGGCG
GACCAGCAGCCCGCGGCCGGGATCCAAGGCCCTCTCGCGGAGCCGACGACGGCAGAGGATACGGCCTGGACCAAA
GACGAAGTCGATCCCTTCCCGCTACCGGACTCGGAACCGGCGCTGGACCCGGCCCACGGAGACGTCGTCTACCTG
ACATCCGAGTCTCCCTACACGCTTCGCCGACTCGAGCCCAACACCATCTACGTCGTCGGCGGGCTCGTCGACCGC
AACCGCGAAAAGGGCCTCTGCTACCGCCGCGCCCGAGAGAGGGGAATCCGGACGGCCAGGCTGCCCATCACCGAC
TTCATGCGTATGCAGAGCCGCCGCGTGCTGGCTACCAACCACGTCGTCGAGATTCTGCTTAGCTGGATGGACTGC
GGTGACTGGGGGGATGCCTTTTTGGCTGTCATTCCCAAGCGCAAGGGCGGGTGTCTCATTCGAGATGATGAGGAG
GGGGAGCCGGATGCTGAGGCTGAGGCGTCGTTGGTTCGAGAAGAGGAGTCGACGATGGGGGAGGTGGTTGACGAG
GCATGTTTACCAGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail