Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3200
Gene name
LocationContig_285:910..2535
Strand-
Gene length (bp)1625
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.4E-27 120 432

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 58 502 4.0E-58
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 25 502 3.0E-54
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 58 491 2.0E-22
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 106 495 4.0E-20
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 98 482 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 58 502 4.0E-58
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 25 502 3.0E-54
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 58 491 2.0E-22
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 106 495 4.0E-20
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 98 482 2.0E-19
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 106 482 5.0E-19
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 60 480 6.0E-19
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 106 495 7.0E-19
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 102 499 9.0E-19
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 106 489 7.0E-18
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 106 462 1.0E-16
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 106 489 3.0E-16
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 106 489 4.0E-16
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 106 480 2.0E-15
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 84 487 3.0E-13
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 84 488 5.0E-13
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 101 467 2.0E-12
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 84 487 5.0E-12
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 97 465 6.0E-12
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 58 470 3.0E-11
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 101 465 2.0E-10
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 101 465 3.0E-10
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 88 483 2.0E-09
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 59 470 2.0E-09
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 101 464 2.0E-09
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 113 470 5.0E-08
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 107 464 5.0E-08
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 107 482 1.0E-07
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 107 465 3.0E-07
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 106 297 4.0E-07
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 90 313 8.0E-07
sp|O95907|MOT3_HUMAN Monocarboxylate transporter 3 OS=Homo sapiens GN=SLC16A8 PE=2 SV=1 103 269 9.0E-07
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 90 304 1.0E-06
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 95 304 2.0E-06
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 106 320 3.0E-06
sp|O70461|MOT3_RAT Monocarboxylate transporter 3 OS=Rattus norvegicus GN=Slc16a8 PE=2 SV=1 107 465 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 116 138 22
2 153 175 22
3 182 200 18
4 204 226 22
5 239 261 22
6 271 293 22
7 318 340 22
8 350 372 22
9 379 401 22
10 406 428 22
11 441 463 22
12 468 490 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3200
MEQEKAGPPMARRAEGSPTEEEKRPKKQAVKMLQPTYRTQMTSVTATTLAGNSTASLSSEKTRHDDQVLDESKPP
FIALSDSDDVEASTPPLPLPTGKTPGPEGFPDGGFDAWLVVAGGWCALFCTFGLINCVGVFQQYYVAGPLRGYGG
SAVSWIMSVQIFIMIFCGTIFGRIFDNYGPKWMLRVGTITYVFGLMMVSLSTKYYQFFLAQSIVSAAGSSAVFNC
CMSSLVTWFMRRRAAAFGIMVSGSSVGGVVLPIMMTQLIRRIGFPWMMRVMAFTFLGLLLIACFTVKSRLPPRPR
PFRALDYVESLKDIRMSVTVAGLFFFMWGMFLPFNYALVQAQAVGTSPALIPYLLPILNAVSIIGRILPGIIADK
IGRFNVMIIISFLSAIFCLAVWTPVNNTTGIIVFMIIFGFSSGGYIGLAPTLIAQISDISQIGTRVGTAFAIQSF
GALTGSPIGGALVSARHGSYLGLQLFCGFAMLIGCCIFVAARYIQAGFKMVKV*
Coding >Ophun1|3200
ATGGAGCAAGAAAAGGCCGGGCCTCCCATGGCGAGGAGGGCTGAAGGCTCCCCGACAGAAGAAGAGAAGAGGCCA
AAGAAGCAAGCCGTCAAGATGCTCCAGCCGACCTACAGGACGCAAATGACGAGCGTGACGGCCACGACGCTGGCC
GGCAACTCAACCGCCTCGCTCTCATCCGAAAAGACACGCCATGACGACCAAGTCCTCGACGAAAGCAAGCCGCCC
TTCATCGCCCTCTCCGACTCGGACGACGTTGAGGCTTCGACGCCGCCGCTGCCGCTGCCGACGGGCAAGACTCCT
GGGCCCGAAGGGTTTCCGGATGGGGGGTTTGATGCCTGGCTTGTTGTTGCGGGGGGCTGGTGTGCCCTGTTCTGC
ACCTTTGGGCTCATCAACTGCGTGGGAGTCTTTCAGCAGTATTACGTTGCTGGGCCGTTGAGGGGTTATGGGGGT
TCGGCGGTTAGTTGGATCATGTCGGTGCAGATCTTCATCATGATCTTTTGCGGTACCATTTTTGGCCGCATCTTC
GACAACTACGGACCCAAATGGATGCTCCGGGTCGGAACCATCACTTACGTCTTCGGTCTGATGATGGTCTCTCTC
TCAACGAAATACTACCAGTTCTTCCTCGCCCAGTCCATCGTCTCGGCCGCCGGTTCCAGCGCCGTCTTCAACTGC
TGCATGTCGTCGCTCGTCACCTGGTTCATGCGCCGCCGAGCCGCGGCCTTTGGCATCATGGTTTCGGGCTCGTCG
GTTGGTGGTGTTGTGCTACCCATTATGATGACGCAGCTCATTCGCCGGATTGGTTTCCCCTGGATGATGCGCGTC
ATGGCTTTCACCTTTTTGGGCTTGTTGCTCATCGCTTGCTTTACTGTCAAGTCGCGTCTGCCGCCGCGGCCGAGG
CCCTTTCGCGCTTTGGACTATGTTGAGAGTCTCAAGGATATTCGCATGTCCGTCACCGTTGCCGGCTTGTTCTTC
TTCATGTGGGGGATGTTTTTGCCTTTCAATTATGCCCTGGTTCAGGCTCAGGCTGTGGGCACCTCGCCGGCTTTG
ATTCCTTACTTGCTGCCCATCCTCAACGCTGTGAGCATCATCGGCCGCATCCTGCCCGGCATCATCGCCGACAAA
ATCGGCCGGTTCAACGTCATGATCATCATCAGCTTCCTCTCCGCCATCTTCTGCCTCGCCGTCTGGACGCCCGTC
AACAACACGACCGGCATCATCGTCTTCATGATCATCTTTGGCTTCTCGTCCGGCGGCTACATCGGCCTGGCTCCG
ACGCTCATTGCCCAGATCTCCGACATTAGCCAGATCGGCACACGGGTTGGCACCGCCTTTGCCATCCAGTCGTTT
GGCGCCTTGACCGGCAGCCCCATTGGCGGTGCTCTTGTTTCCGCTCGTCATGGCTCGTACTTGGGTCTGCAGCTT
TTTTGCGGCTTTGCCATGTTGATTGGCTGCTGCATCTTTGTTGCTGCCAGGTATATTCAGGCTGGCTTTAAGATG
GTCAAGGTTTGA
Transcript >Ophun1|3200
ATGGAGCAAGAAAAGGCCGGGCCTCCCATGGCGAGGAGGGCTGAAGGCTCCCCGACAGAAGAAGAGAAGAGGCCA
AAGAAGCAAGCCGTCAAGATGCTCCAGCCGACCTACAGGACGCAAATGACGAGCGTGACGGCCACGACGCTGGCC
GGCAACTCAACCGCCTCGCTCTCATCCGAAAAGACACGCCATGACGACCAAGTCCTCGACGAAAGCAAGCCGCCC
TTCATCGCCCTCTCCGACTCGGACGACGTTGAGGCTTCGACGCCGCCGCTGCCGCTGCCGACGGGCAAGACTCCT
GGGCCCGAAGGGTTTCCGGATGGGGGGTTTGATGCCTGGCTTGTTGTTGCGGGGGGCTGGTGTGCCCTGTTCTGC
ACCTTTGGGCTCATCAACTGCGTGGGAGTCTTTCAGCAGTATTACGTTGCTGGGCCGTTGAGGGGTTATGGGGGT
TCGGCGGTTAGTTGGATCATGTCGGTGCAGATCTTCATCATGATCTTTTGCGGTACCATTTTTGGCCGCATCTTC
GACAACTACGGACCCAAATGGATGCTCCGGGTCGGAACCATCACTTACGTCTTCGGTCTGATGATGGTCTCTCTC
TCAACGAAATACTACCAGTTCTTCCTCGCCCAGTCCATCGTCTCGGCCGCCGGTTCCAGCGCCGTCTTCAACTGC
TGCATGTCGTCGCTCGTCACCTGGTTCATGCGCCGCCGAGCCGCGGCCTTTGGCATCATGGTTTCGGGCTCGTCG
GTTGGTGGTGTTGTGCTACCCATTATGATGACGCAGCTCATTCGCCGGATTGGTTTCCCCTGGATGATGCGCGTC
ATGGCTTTCACCTTTTTGGGCTTGTTGCTCATCGCTTGCTTTACTGTCAAGTCGCGTCTGCCGCCGCGGCCGAGG
CCCTTTCGCGCTTTGGACTATGTTGAGAGTCTCAAGGATATTCGCATGTCCGTCACCGTTGCCGGCTTGTTCTTC
TTCATGTGGGGGATGTTTTTGCCTTTCAATTATGCCCTGGTTCAGGCTCAGGCTGTGGGCACCTCGCCGGCTTTG
ATTCCTTACTTGCTGCCCATCCTCAACGCTGTGAGCATCATCGGCCGCATCCTGCCCGGCATCATCGCCGACAAA
ATCGGCCGGTTCAACGTCATGATCATCATCAGCTTCCTCTCCGCCATCTTCTGCCTCGCCGTCTGGACGCCCGTC
AACAACACGACCGGCATCATCGTCTTCATGATCATCTTTGGCTTCTCGTCCGGCGGCTACATCGGCCTGGCTCCG
ACGCTCATTGCCCAGATCTCCGACATTAGCCAGATCGGCACACGGGTTGGCACCGCCTTTGCCATCCAGTCGTTT
GGCGCCTTGACCGGCAGCCCCATTGGCGGTGCTCTTGTTTCCGCTCGTCATGGCTCGTACTTGGGTCTGCAGCTT
TTTTGCGGCTTTGCCATGTTGATTGGCTGCTGCATCTTTGTTGCTGCCAGGTATATTCAGGCTGGCTTTAAGATG
GTCAAGGTTTGA
Gene >Ophun1|3200
ATGGAGCAAGAAAAGGCCGGGCCTCCCATGGCGAGGAGGGCTGAAGGCTCCCCGACAGAAGAAGAGAAGAGGCCA
AAGAAGCAAGCCGTCAAGATGCTCCAGCCGACCTACAGGACGCAAATGACGAGCGTGACGGCCACGACGCTGGCC
GGCAACTCAACCGCCTCGCTCTCATCCGAAAAGACACGCCATGACGACCAAGTCCTCGACGAAAGCAAGCCGCCC
TTCATCGCCCTCTCCGACTCGGACGACGTTGAGGCTTCGACGCCGCCGCTGCCGCTGCCGACGGGCAAGACTCCT
GGGCCCGAAGGGTTTCCGGATGGGGGGTTTGATGCCTGGCTTGTTGTTGCGGGGGGCTGGTGTGCCCTGTTCTGC
ACCTTTGGGCTCATCAACTGCGTGGGAGTCTTTCAGCAGTATTACGTTGCTGGGCCGTTGAGGGGTTATGGGGGT
TCGGCGGTTAGTTGGATCATGTCGGTGCAGATCTTCATCATGATCTTTTGCGGTACCATTGTGAGTCTTTTCTGG
CTGGTTTCTTTCTTTACTGGGTTGGCTGACGGTGTCAGTTTGGCCGCATCTTCGACAACTACGGACCCAAATGGA
TGCTCCGGGTCGGAACCATCACTTACGTCTTCGGTCTGATGATGGTCTCTCTCTCAACGAAATACTACCAGTTCT
TCCTCGCCCAGTCCATCGTCTCGGCCGCCGGTTCCAGCGCCGTCTTCAACTGCTGCATGTCGTCGCTCGTCACCT
GGTTCATGCGCCGCCGAGCCGCGGCCTTTGGCATCATGGTTTCGGGCTCGTCGGTTGGTGGTGTTGTGCTACCCA
TTATGATGACGCAGCTCATTCGCCGGATTGGTTTCCCCTGGATGATGCGCGTCATGGCTTTCACCTTTTTGGGCT
TGTTGCTCATCGCTTGCTTTACTGTCAAGTCGCGTCTGCCGCCGCGGCCGAGGCCCTTTCGCGCTTTGGACTATG
TTGAGAGTCTCAAGGATATTCGCATGTCCGTCACCGTTGCCGGCTTGTTCTTCTTCATGTGGGGGATGTTTTTGC
CTTTCAATTATGCCCTGGTTCAGGCTCAGGCTGTGGGCACCTCGCCGGCTTTGATTCCTTACTTGCTGCCCATCC
TCAACGCTGTGAGGTGAGTTTTCTTCTTCGCTGCTCTGATAGTGTCATAGTCTGACGAGACGGAACCTCACAGCA
TCATCGGCCGCATCCTGCCCGGCATCATCGCCGACAAAATCGGCCGGTTCAACGTCATGATCATCATCAGCTTCC
TCTCCGCCATCTTCTGCCTCGCCGTCTGGACGCCCGTCAACAACACGACCGGCATCATCGTCTTCATGATCATCT
TTGGCTTCTCGTCCGGCGGCTACATCGGCCTGGCTCCGACGCTCATTGCCCAGATCTCCGACATTAGCCAGATCG
GCACACGGGTTGGCACCGCCTTTGCCATCCAGTCGTTTGGCGCCTTGACCGGCAGCCCCATTGGCGGTGCTCTTG
TTTCCGCTCGTCATGGCTCGTACTTGGGTCTGCAGCTTTTTTGCGGCTTTGCCATGTTGATTGGCTGCTGCATCT
TTGTTGCTGCCAGGTATATTCAGGCTGGCTTTAAGATGGTCAAGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail