Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3199
Gene name
LocationContig_285:14..580
Strand-
Gene length (bp)566
Transcript length (bp)444
Coding sequence length (bp)444
Protein length (aa) 148

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 7.3E-12 19 107
PF13857 Ank_5 Ankyrin repeats (many copies) 3.1E-11 40 85
PF00023 Ank Ankyrin repeat 5.5E-08 47 78
PF13606 Ank_3 Ankyrin repeat 2.0E-06 47 74

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 10 128 9.0E-27
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 10 107 6.0E-14
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 10 107 1.0E-13
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 10 107 1.0E-13
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 10 107 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HYV6|Y3287_PSEAE Putative ankyrin repeat protein PA3287 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3287 PE=3 SV=1 10 128 9.0E-27
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 10 107 6.0E-14
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 10 107 1.0E-13
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 10 107 1.0E-13
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 10 107 2.0E-13
sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 21 117 7.0E-11
sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 21 117 7.0E-11
sp|P57044|ILK_CAVPO Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 16 104 3.0E-10
sp|Q3SWY2|ILK_BOVIN Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 16 104 3.0E-10
sp|Q5R5V4|ILK_PONAB Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 16 104 3.0E-10
sp|Q13418|ILK_HUMAN Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 16 104 3.0E-10
sp|Q99J82|ILK_RAT Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 16 104 4.0E-10
sp|O55222|ILK_MOUSE Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 16 104 4.0E-10
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 18 107 8.0E-10
sp|Q6DGX3|ANR54_DANRE Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 17 107 1.0E-09
sp|Q7M6U3|TEX14_MOUSE Inactive serine/threonine-protein kinase TEX14 OS=Mus musculus GN=Tex14 PE=1 SV=2 13 105 1.0E-09
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 18 107 2.0E-09
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 18 107 2.0E-09
sp|Q6TGW5|OSTF1_DANRE Osteoclast-stimulating factor 1 OS=Danio rerio GN=ostf1 PE=2 SV=1 18 122 2.0E-09
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 5 107 7.0E-09
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 5 105 8.0E-09
sp|Q66JD7|ACBD6_XENTR Acyl-CoA-binding domain-containing protein 6 OS=Xenopus tropicalis GN=acbd6 PE=2 SV=1 18 106 8.0E-09
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 16 110 8.0E-09
sp|F1MJR8|TEX14_BOVIN Inactive serine/threonine-protein kinase TEX14 OS=Bos taurus GN=TEX14 PE=3 SV=2 13 105 9.0E-09
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 15 108 1.0E-08
sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 18 106 1.0E-08
sp|Q9UVH3|AKR1_MORAP Palmitoyltransferase AKR1 (Fragment) OS=Mortierella alpina PE=3 SV=1 27 143 2.0E-08
sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 21 105 2.0E-08
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 5 105 2.0E-08
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 18 106 2.0E-08
sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 21 117 2.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 21 108 3.0E-08
sp|Q9TZC4|ILKH_CAEEL Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 16 104 3.0E-08
sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 18 106 3.0E-08
sp|Q9P0K7|RAI14_HUMAN Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 18 105 3.0E-08
sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 19 116 4.0E-08
sp|Q5B0V6|AKR1_EMENI Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 18 105 5.0E-08
sp|Q54HW1|PSD10_DICDI 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 18 104 5.0E-08
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 18 118 5.0E-08
sp|Q4V869|ACBD6_XENLA Acyl-CoA-binding domain-containing protein 6 OS=Xenopus laevis GN=acbd6 PE=2 SV=1 18 106 5.0E-08
sp|Q9D2X0|ANR39_MOUSE Ankyrin repeat domain-containing protein 39 OS=Mus musculus GN=Ankrd39 PE=1 SV=1 18 101 6.0E-08
sp|F1M5M3|TEX14_RAT Inactive serine/threonine-protein kinase TEX14 OS=Rattus norvegicus GN=Tex14 PE=1 SV=2 13 105 6.0E-08
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 16 105 7.0E-08
sp|Q53RE8|ANR39_HUMAN Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 18 101 7.0E-08
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 16 105 7.0E-08
sp|Q9D2J7|ANKE1_MOUSE Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 23 107 7.0E-08
sp|Q6XJU9|OSTF1_MONAL Osteoclast-stimulating factor 1 OS=Monopterus albus GN=ostf1 PE=2 SV=1 18 107 9.0E-08
sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 21 143 9.0E-08
sp|Q5RJK8|ACBD6_RAT Acyl-CoA-binding domain-containing protein 6 OS=Rattus norvegicus GN=Acbd6 PE=1 SV=1 18 106 9.0E-08
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 18 108 1.0E-07
sp|Q1RK13|Y220_RICBR Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 5 110 1.0E-07
sp|Q9STP8|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2 OS=Arabidopsis thaliana GN=ACBP2 PE=1 SV=1 18 105 1.0E-07
sp|Q91ZT8|ASB9_MOUSE Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 10 106 1.0E-07
sp|Q05921|RN5A_MOUSE 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 11 105 1.0E-07
sp|Q7T0Q1|MTPN_XENLA Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 21 129 2.0E-07
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 18 135 2.0E-07
sp|Q9D061|ACBD6_MOUSE Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2 18 106 2.0E-07
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 15 108 2.0E-07
sp|Q5U312|RAI14_RAT Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 18 135 3.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 18 104 3.0E-07
sp|Q54XX5|Y9849_DICDI Probable serine/threonine-protein kinase DDB_G0278535 OS=Dictyostelium discoideum GN=DDB_G0278535 PE=3 SV=1 34 105 3.0E-07
sp|Q3UMR0|ANR27_MOUSE Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 18 135 3.0E-07
sp|Q96NW4|ANR27_HUMAN Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 18 135 3.0E-07
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 21 104 4.0E-07
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 21 104 4.0E-07
sp|Q8IWB6|TEX14_HUMAN Inactive serine/threonine-protein kinase TEX14 OS=Homo sapiens GN=TEX14 PE=1 SV=2 13 105 4.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 18 104 4.0E-07
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 21 112 5.0E-07
sp|Q4X251|AKR1_ASPFU Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 18 105 5.0E-07
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 28 105 5.0E-07
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 21 104 6.0E-07
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 18 108 6.0E-07
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 18 108 6.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 18 107 6.0E-07
sp|Q07E15|CTTB2_MUSPF Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 16 105 6.0E-07
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 15 107 6.0E-07
sp|Q6B858|FANK1_BOVIN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 15 115 6.0E-07
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 15 107 6.0E-07
sp|Q9NU02|ANKE1_HUMAN Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 23 104 6.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 18 107 6.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 22 107 7.0E-07
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 18 105 7.0E-07
sp|Q06527|ANKH_ALLVD Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 36 108 7.0E-07
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 41 105 7.0E-07
sp|Q5DU14|MYO16_MOUSE Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 27 135 7.0E-07
sp|Q86YT6|MIB1_HUMAN E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 41 105 7.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 18 114 8.0E-07
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 18 118 8.0E-07
sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 20 104 8.0E-07
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 18 117 8.0E-07
sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 18 106 8.0E-07
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 16 105 8.0E-07
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 21 122 8.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 18 114 8.0E-07
sp|Q0P5B9|ANR39_BOVIN Ankyrin repeat domain-containing protein 39 OS=Bos taurus GN=ANKRD39 PE=2 SV=1 18 101 9.0E-07
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 18 110 9.0E-07
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 25 108 9.0E-07
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 15 108 9.0E-07
sp|Q68DC2|ANKS6_HUMAN Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 21 115 9.0E-07
sp|Q9EP71|RAI14_MOUSE Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 18 105 9.0E-07
sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 5 105 9.0E-07
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 18 143 9.0E-07
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 21 104 1.0E-06
sp|Q07E28|CTTB2_NEONE Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 18 125 1.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 21 112 1.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 18 114 1.0E-06
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 18 107 1.0E-06
sp|Q495B1|AKD1A_HUMAN Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 16 145 1.0E-06
sp|Q8N8V4|ANS4B_HUMAN Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens GN=ANKS4B PE=1 SV=2 14 105 1.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 18 104 1.0E-06
sp|Q6GNY1|MIB1_XENLA E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 18 105 1.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 18 104 1.0E-06
sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 18 106 1.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 21 106 1.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 18 107 1.0E-06
sp|Q96JP0|FEM1C_HUMAN Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 5 105 1.0E-06
sp|A7MB89|FEM1C_BOVIN Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 5 105 1.0E-06
sp|Q9WV74|ASB1_MOUSE Ankyrin repeat and SOCS box protein 1 OS=Mus musculus GN=Asb1 PE=2 SV=1 21 107 1.0E-06
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 10 105 1.0E-06
sp|Q8CEF1|FEM1C_MOUSE Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 5 105 1.0E-06
sp|Q8K3X6|ANS4B_MOUSE Ankyrin repeat and SAM domain-containing protein 4B OS=Mus musculus GN=Anks4b PE=1 SV=1 14 105 1.0E-06
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 18 107 1.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 18 107 1.0E-06
sp|Q07DW4|CTTB2_MUNRE Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 16 105 1.0E-06
sp|A0M8T5|CTTB2_FELCA Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 18 122 2.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 18 107 2.0E-06
sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 18 105 2.0E-06
sp|Q54F46|WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 35 107 2.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 21 107 2.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 18 105 2.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 18 105 2.0E-06
sp|Q9EQG6|KDIS_RAT Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 18 104 2.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 14 104 2.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 18 107 2.0E-06
sp|Q9Y575|ASB3_HUMAN Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 18 105 2.0E-06
sp|Q6NSI1|AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens GN=ANKRD26P1 PE=5 SV=2 17 112 2.0E-06
sp|Q9J5H8|V023_FOWPN Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 16 107 2.0E-06
sp|Q4UKX2|Y950_RICFE Putative ankyrin repeat protein RF_0950 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0950 PE=3 SV=1 18 107 2.0E-06
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 18 107 2.0E-06
sp|Q1RHT6|Y997_RICBR Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 18 111 2.0E-06
sp|Q63369|NFKB1_RAT Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 15 105 2.0E-06
sp|Q07DV1|CTTB2_AOTNA Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 16 105 2.0E-06
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 29 104 2.0E-06
sp|Q5ZJJ9|OSTF1_CHICK Osteoclast-stimulating factor 1 OS=Gallus gallus GN=OSTF1 PE=2 SV=1 18 107 2.0E-06
sp|Q8WXK4|ASB12_HUMAN Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 49 106 2.0E-06
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 44 108 2.0E-06
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 18 107 2.0E-06
sp|F8W2M1|HACE1_DANRE E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 41 123 2.0E-06
sp|Q09YG9|CTTB2_SAIBB Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 16 105 2.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 18 107 2.0E-06
sp|Q09YK4|CTTB2_ATEGE Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 16 105 2.0E-06
sp|Q8MJ50|OSTF1_BOVIN Osteoclast-stimulating factor 1 OS=Bos taurus GN=OSTF1 PE=2 SV=1 18 107 2.0E-06
sp|Q7T2B9|MTPN_DANRE Myotrophin OS=Danio rerio GN=mtpn PE=3 SV=1 21 118 2.0E-06
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 21 104 2.0E-06
sp|O75832|PSD10_HUMAN 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 18 107 2.0E-06
sp|Q9VFD5|FEM1A_DROME Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 21 114 2.0E-06
sp|Q7Z8U2|AKR1_ASPOR Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 18 105 2.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 21 114 2.0E-06
sp|Q7ZYG4|OSTF1_XENLA Osteoclast-stimulating factor 1 OS=Xenopus laevis GN=ostf1 PE=2 SV=1 18 122 2.0E-06
sp|E1C656|HACE1_CHICK E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 41 123 2.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 18 107 2.0E-06
sp|Q2QLF8|CTTB2_CALJA Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 16 105 2.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 16 105 2.0E-06
sp|Q3SX45|ASB2_BOVIN Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 15 113 2.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 21 104 3.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 18 108 3.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 18 104 3.0E-06
sp|Q108T9|CTTB2_LOXAF Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 16 105 3.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 18 115 3.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 16 105 3.0E-06
sp|Q09YJ3|CTTB2_MUNMU Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 16 105 3.0E-06
sp|Q6P686|OSTF1_RAT Osteoclast-stimulating factor 1 OS=Rattus norvegicus GN=Ostf1 PE=1 SV=1 18 107 3.0E-06
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 41 104 3.0E-06
sp|P25799|NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 15 105 3.0E-06
sp|Q8NFD2|ANKK1_HUMAN Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 18 107 3.0E-06
sp|Q62422|OSTF1_MOUSE Osteoclast-stimulating factor 1 OS=Mus musculus GN=Ostf1 PE=1 SV=2 18 107 3.0E-06
sp|P19838|NFKB1_HUMAN Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 15 105 3.0E-06
sp|Q9SM23|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1 OS=Arabidopsis thaliana GN=ACBP1 PE=1 SV=2 22 133 3.0E-06
sp|Q92882|OSTF1_HUMAN Osteoclast-stimulating factor 1 OS=Homo sapiens GN=OSTF1 PE=1 SV=2 18 107 3.0E-06
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 47 105 3.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 16 105 3.0E-06
sp|Q2QLA2|CTTB2_HORSE Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 16 105 3.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 21 106 3.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 16 105 3.0E-06
sp|P17221|FEM1_CAEEL Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 21 104 3.0E-06
sp|Q6P1S6|MTPN_XENTR Myotrophin OS=Xenopus tropicalis GN=mtpn PE=3 SV=1 21 118 3.0E-06
sp|Q9Y576|ASB1_HUMAN Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 21 107 3.0E-06
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 34 104 3.0E-06
sp|Q9Z2X2|PSD10_MOUSE 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 18 107 3.0E-06
sp|Q9Y2G4|ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 18 141 3.0E-06
sp|Q8IYU2|HACE1_HUMAN E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 41 123 3.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 15 105 3.0E-06
sp|Q8UVC1|INVS_DANRE Inversin OS=Danio rerio GN=invs PE=2 SV=1 16 108 3.0E-06
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 21 104 4.0E-06
sp|Q2KI79|ANRA2_BOVIN Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 21 119 4.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 21 107 4.0E-06
sp|Q99PE2|ANRA2_MOUSE Ankyrin repeat family A protein 2 OS=Mus musculus GN=Ankra2 PE=1 SV=1 21 119 4.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 18 107 4.0E-06
sp|Q9WV74|ASB1_MOUSE Ankyrin repeat and SOCS box protein 1 OS=Mus musculus GN=Asb1 PE=2 SV=1 16 107 4.0E-06
sp|Q7T3P8|FEM1C_DANRE Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 21 104 4.0E-06
sp|Q2T9K6|FEM1C_XENLA Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 5 105 4.0E-06
sp|Q9ULH0|KDIS_HUMAN Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 18 104 4.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 18 100 4.0E-06
sp|Q96Q27|ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 18 104 4.0E-06
sp|Q8C0W1|ANMY1_MOUSE Ankyrin repeat and MYND domain-containing protein 1 OS=Mus musculus GN=Ankmy1 PE=1 SV=1 14 90 4.0E-06
sp|Q69ZU8|ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 18 95 4.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 34 104 4.0E-06
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 16 105 4.0E-06
sp|D3ZBM7|HACE1_RAT E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 41 123 4.0E-06
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 47 105 4.0E-06
sp|Q2IBB2|CTTB2_RHIFE Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 16 105 4.0E-06
sp|Q3U0D9|HACE1_MOUSE E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 41 123 4.0E-06
sp|Q9H9E1|ANRA2_HUMAN Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 21 119 5.0E-06
sp|Q6GQX6|ANKS6_MOUSE Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 16 112 5.0E-06
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 18 107 5.0E-06
sp|Q09YM8|CTTB2_RABIT Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 16 105 5.0E-06
sp|Q9Y576|ASB1_HUMAN Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 16 107 5.0E-06
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 18 100 5.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 15 105 6.0E-06
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 21 105 6.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 21 105 6.0E-06
sp|O89019|INVS_MOUSE Inversin OS=Mus musculus GN=Invs PE=1 SV=2 21 107 6.0E-06
sp|Q2QL82|CTTB2_MICMU Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 18 130 6.0E-06
sp|Q2IBF7|CTTB2_GORGO Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 18 130 6.0E-06
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 16 106 6.0E-06
sp|Q2IBF8|CTTB2_EULMM Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 16 105 6.0E-06
sp|Q9HFE7|YNW5_SCHPO Ankyrin repeat-containing protein P16F5.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP16F5.05c PE=3 SV=1 16 100 6.0E-06
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 16 105 6.0E-06
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 11 106 6.0E-06
sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 14 105 7.0E-06
sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 18 130 7.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 18 104 7.0E-06
sp|Q00PJ1|CTTB2_ATEAB Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 18 143 7.0E-06
sp|Q2QLG9|CTTB2_OTOGA Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 16 105 7.0E-06
sp|Q9Y6X6|MYO16_HUMAN Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 27 106 7.0E-06
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 15 105 7.0E-06
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 18 100 7.0E-06
sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 18 108 7.0E-06
sp|P0C0T2|ANKS6_RAT Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 16 112 8.0E-06
sp|Q8MJ49|OSTF1_PIG Osteoclast-stimulating factor 1 OS=Sus scrofa GN=OSTF1 PE=2 SV=1 18 107 8.0E-06
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 15 105 8.0E-06
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 18 130 8.0E-06
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 15 105 8.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 25 108 8.0E-06
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 34 114 9.0E-06
sp|Q09YI1|CTTB2_SHEEP Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 18 143 9.0E-06
sp|Q9ERC1|MYO16_RAT Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 27 135 9.0E-06
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 25 108 9.0E-06
sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 11 104 9.0E-06
sp|Q502M6|ANR29_DANRE Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 15 101 9.0E-06
sp|Q2IBA2|CTTB2_CHLAE Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 16 105 9.0E-06
sp|Q3V096|ANR42_MOUSE Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 18 106 9.0E-06
sp|Q07DY4|CTTB2_COLGU Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 16 105 9.0E-06
sp|A0M8S4|CTTB2_PAPAN Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 16 105 9.0E-06
sp|Q07E41|CTTB2_DASNO Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 18 143 9.0E-06
sp|Q07DX4|CTTB2_NOMLE Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 18 130 1.0E-05
sp|Q2IBE6|CTTB2_PONAB Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 16 105 1.0E-05
sp|Q8N6D5|ANR29_HUMAN Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 14 108 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2556
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6710
Ophiocordyceps australis map64 (Brazil) OphauB2|3716
Ophiocordyceps camponoti-floridani Ophcf2|03181
Ophiocordyceps camponoti-rufipedis Ophun1|3199 (this protein)
Ophiocordyceps kimflemingae Ophio5|421
Ophiocordyceps subramaniannii Hirsu2|3796

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3199
MDAPEAAPPEVIALASRMYDAARQGDLTVLQQALPAGLPANLTNEKGETLLMLAAYHGHAAVVQLLLDHGADPNR
LNDRGQSPLAGAVFKAEDDVIETLLRGGADPDYGAPTALQCVDMFKQGDKWASKMEDAPGRGKAQSSRPEGV*
Coding >Ophun1|3199
ATGGACGCCCCCGAAGCAGCACCACCCGAAGTCATCGCTCTCGCATCTCGCATGTACGACGCCGCCCGTCAAGGC
GACCTGACCGTCTTGCAGCAAGCCCTGCCAGCCGGCCTGCCAGCCAACCTGACCAACGAAAAGGGCGAGACGCTG
CTCATGCTTGCTGCGTATCATGGCCATGCGGCTGTTGTGCAGCTGCTGCTCGATCACGGCGCTGATCCGAACCGG
CTCAATGATCGGGGGCAGAGTCCTCTTGCCGGCGCCGTATTCAAGGCTGAGGATGATGTGATTGAGACGCTGCTC
CGGGGCGGGGCCGATCCGGACTACGGAGCTCCGACTGCCCTGCAATGCGTCGACATGTTCAAGCAGGGGGATAAG
TGGGCGAGCAAGATGGAGGACGCTCCGGGACGCGGTAAGGCGCAGTCAAGCCGGCCTGAAGGTGTTTAA
Transcript >Ophun1|3199
ATGGACGCCCCCGAAGCAGCACCACCCGAAGTCATCGCTCTCGCATCTCGCATGTACGACGCCGCCCGTCAAGGC
GACCTGACCGTCTTGCAGCAAGCCCTGCCAGCCGGCCTGCCAGCCAACCTGACCAACGAAAAGGGCGAGACGCTG
CTCATGCTTGCTGCGTATCATGGCCATGCGGCTGTTGTGCAGCTGCTGCTCGATCACGGCGCTGATCCGAACCGG
CTCAATGATCGGGGGCAGAGTCCTCTTGCCGGCGCCGTATTCAAGGCTGAGGATGATGTGATTGAGACGCTGCTC
CGGGGCGGGGCCGATCCGGACTACGGAGCTCCGACTGCCCTGCAATGCGTCGACATGTTCAAGCAGGGGGATAAG
TGGGCGAGCAAGATGGAGGACGCTCCGGGACGCGGTAAGGCGCAGTCAAGCCGGCCTGAAGGTGTTTAA
Gene >Ophun1|3199
ATGGACGCCCCCGAAGCAGCACCACCCGAAGTCATCGCTCTCGCATCTCGCATGTACGACGCCGCCCGTCAAGGC
GACCTGACCGTCTTGCAGCAAGCCCTGCCAGCCGGCCTGCCAGCCAACCTGACCAACGAAAAGGGCGAGACGCTG
GTGGGTGGTCGGACAGAGCAATGATGATGGGCGAGAGGCTGAGACACTGCTGGAGCTCATGCTTGCTGCGTATCA
TGGCCATGCGGCTGTTGTGCAGCTGCTGCTCGATCACGGCGCTGATCCGAACCGGCTCAATGATCGGGGGCAGAG
TCCTCTTGCCGGCGCCGTATTCAAGGCTGAGGATGATGTGATTGAGGTGGGCTGGGCTATTCTCTCGTCGTATTT
GCTCGGTGTTTCTCACTTCTCGGTGCCGGTGCCGGTAGACGCTGCTCCGGGGCGGGGCCGATCCGGACTACGGAG
CTCCGACTGCCCTGCAATGCGTCGACATGTTCAAGCAGGGGGATAAGTGGGCGAGCAAGATGGAGGACGCTCCGG
GACGCGGTAAGGCGCAGTCAAGCCGGCCTGAAGGTGTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail