Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3195
Gene name
LocationContig_284:10544..11698
Strand+
Gene length (bp)1154
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11788 MRP-L46 39S mitochondrial ribosomal protein L46 3.0E-26 67 203

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 72 340 1.0E-23
sp|O94398|RM17_SCHPO 54S ribosomal protein L17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl17 PE=3 SV=1 53 341 3.0E-18
sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 59 340 5.0E-15
sp|Q3SZ22|RM46_BOVIN 39S ribosomal protein L46, mitochondrial OS=Bos taurus GN=MRPL46 PE=2 SV=1 59 340 1.0E-13
sp|Q9EQI8|RM46_MOUSE 39S ribosomal protein L46, mitochondrial OS=Mus musculus GN=Mrpl46 PE=1 SV=1 73 340 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P36528|RM17_YEAST 54S ribosomal protein L17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL17 PE=1 SV=2 72 340 1.0E-23
sp|O94398|RM17_SCHPO 54S ribosomal protein L17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl17 PE=3 SV=1 53 341 3.0E-18
sp|Q5RK00|RM46_RAT 39S ribosomal protein L46, mitochondrial OS=Rattus norvegicus GN=Mrpl46 PE=2 SV=1 59 340 5.0E-15
sp|Q3SZ22|RM46_BOVIN 39S ribosomal protein L46, mitochondrial OS=Bos taurus GN=MRPL46 PE=2 SV=1 59 340 1.0E-13
sp|Q9EQI8|RM46_MOUSE 39S ribosomal protein L46, mitochondrial OS=Mus musculus GN=Mrpl46 PE=1 SV=1 73 340 2.0E-12
sp|Q9H2W6|RM46_HUMAN 39S ribosomal protein L46, mitochondrial OS=Homo sapiens GN=MRPL46 PE=1 SV=1 59 340 3.0E-12
sp|Q5RBU2|RM46_PONAB 39S ribosomal protein L46, mitochondrial OS=Pongo abelii GN=MRPL46 PE=2 SV=1 59 340 3.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3195
MSASSRGGRVLGGALSASARKQVCFRCAAAASIRPFSSAAAVESTVMTSQTISTMQKLSPASESLPYDLYSGVIL
TRAPLLTRKLHPFENAFFFYQKRLEERLCSKFIPRIYYKKDTVRLLDWEVKIKERKGHVAKELGEYQGQNSMAWD
DELRVGDRLSEPESMVECLLKDAESRVSDDAEVLAPEDVVPVPRPASRETEADRVGDVTRLDRKLDRTLYLVVKG
NEGWGFPAGVMGNEENLHEAARRVLDTAAGVDMNTWIIGRVPVAHIVAPPVVDANGSILQRTRKTFFLKARIIAG
QANLSDNPFGFTQFKWLVREEVEEVLAPEYFQKVRNMMPDR*
Coding >Ophun1|3195
ATGTCGGCCAGCAGCAGAGGCGGTCGCGTCCTGGGCGGCGCATTGAGCGCTTCGGCGCGGAAGCAGGTTTGCTTT
CGATGCGCTGCCGCCGCCTCCATCCGGCCTTTTTCGTCTGCCGCGGCGGTTGAGTCGACGGTCATGACCTCCCAG
ACGATCTCTACGATGCAGAAGCTATCTCCTGCTTCGGAATCGCTGCCGTACGACCTCTACTCGGGCGTGATCCTG
ACGCGGGCACCTCTCCTAACGCGAAAGCTGCACCCCTTCGAAAACGCCTTCTTCTTCTACCAAAAGCGGCTCGAA
GAACGACTGTGCTCCAAGTTCATCCCGCGGATCTACTACAAGAAGGACACGGTGCGTCTGCTGGACTGGGAAGTC
AAGATCAAGGAGCGGAAGGGGCACGTCGCCAAGGAGCTGGGGGAGTACCAGGGGCAGAATTCCATGGCGTGGGAC
GACGAGCTGCGTGTTGGCGATAGGCTGAGCGAGCCGGAGAGTATGGTGGAGTGCTTGCTCAAGGATGCGGAGTCG
AGGGTTTCGGACGATGCTGAGGTTTTGGCGCCTGAGGATGTCGTTCCGGTGCCTAGGCCGGCTTCCAGGGAGACG
GAGGCGGATAGGGTGGGGGATGTTACCAGGTTGGATAGGAAGCTTGATCGGACGCTCTATCTTGTTGTCAAGGGG
AACGAGGGATGGGGGTTTCCGGCTGGTGTCATGGGCAATGAGGAGAACCTCCACGAAGCAGCGCGACGCGTCCTC
GACACAGCAGCAGGCGTCGACATGAACACCTGGATAATAGGCCGCGTCCCCGTCGCCCACATCGTCGCCCCGCCC
GTCGTCGACGCCAACGGCAGCATCCTCCAGCGCACGCGCAAGACCTTCTTCCTCAAGGCTCGCATCATCGCCGGC
CAGGCTAACCTCTCTGATAACCCCTTTGGCTTCACGCAGTTCAAGTGGCTCGTTAGGGAGGAGGTGGAGGAGGTG
CTGGCGCCGGAGTACTTTCAGAAAGTGCGCAATATGATGCCTGATCGGTGA
Transcript >Ophun1|3195
ATGTCGGCCAGCAGCAGAGGCGGTCGCGTCCTGGGCGGCGCATTGAGCGCTTCGGCGCGGAAGCAGGTTTGCTTT
CGATGCGCTGCCGCCGCCTCCATCCGGCCTTTTTCGTCTGCCGCGGCGGTTGAGTCGACGGTCATGACCTCCCAG
ACGATCTCTACGATGCAGAAGCTATCTCCTGCTTCGGAATCGCTGCCGTACGACCTCTACTCGGGCGTGATCCTG
ACGCGGGCACCTCTCCTAACGCGAAAGCTGCACCCCTTCGAAAACGCCTTCTTCTTCTACCAAAAGCGGCTCGAA
GAACGACTGTGCTCCAAGTTCATCCCGCGGATCTACTACAAGAAGGACACGGTGCGTCTGCTGGACTGGGAAGTC
AAGATCAAGGAGCGGAAGGGGCACGTCGCCAAGGAGCTGGGGGAGTACCAGGGGCAGAATTCCATGGCGTGGGAC
GACGAGCTGCGTGTTGGCGATAGGCTGAGCGAGCCGGAGAGTATGGTGGAGTGCTTGCTCAAGGATGCGGAGTCG
AGGGTTTCGGACGATGCTGAGGTTTTGGCGCCTGAGGATGTCGTTCCGGTGCCTAGGCCGGCTTCCAGGGAGACG
GAGGCGGATAGGGTGGGGGATGTTACCAGGTTGGATAGGAAGCTTGATCGGACGCTCTATCTTGTTGTCAAGGGG
AACGAGGGATGGGGGTTTCCGGCTGGTGTCATGGGCAATGAGGAGAACCTCCACGAAGCAGCGCGACGCGTCCTC
GACACAGCAGCAGGCGTCGACATGAACACCTGGATAATAGGCCGCGTCCCCGTCGCCCACATCGTCGCCCCGCCC
GTCGTCGACGCCAACGGCAGCATCCTCCAGCGCACGCGCAAGACCTTCTTCCTCAAGGCTCGCATCATCGCCGGC
CAGGCTAACCTCTCTGATAACCCCTTTGGCTTCACGCAGTTCAAGTGGCTCGTTAGGGAGGAGGTGGAGGAGGTG
CTGGCGCCGGAGTACTTTCAGAAAGTGCGCAATATGATGCCTGATCGGTGA
Gene >Ophun1|3195
ATGTCGGCCAGCAGCAGAGGCGGTCGCGTCCTGGGCGGCGCATTGAGCGGTATGAGAGCCCTTCTGAAGATGGAG
ATGAAGCTCTAGAGCTGGATGAACTGATTTGACTGATTCTGGGGAGCAGCTTCGGCGCGGAAGCAGGTTTGCTTT
CGATGCGCTGCCGCCGCCTCCATCCGGCCTTTTTCGTCTGCCGCGGCGGTTGAGTCGACGGTCATGACCTCCCAG
ACGATCTCTACGATGCAGAAGCTATCTCCTGCTTCGGAATCGCTGCCGTACGACCTCTACTCGGGCGTGATCCTG
ACGCGGGCACCTCTCCTAACGCGAAAGCTGCACCCCTTCGAAAACGCCTTCTTCTTCTACCAAAAGCGGCTCGAA
GAACGACTGTGCTCCAAGTTCATCCCGCGGATCTACTACAAGAAGGACACGGTGCGTCTGCTGGACTGGGAAGTC
AAGATCAAGGAGCGGAAGGGGCACGTCGCCAAGGAGCTGGGGGAGTACCAGGGGCAGAATTCCATGGCGTGGGAC
GACGAGCTGCGTGTTGGCGATAGGCTGAGCGAGCCGGAGAGTATGGTGGAGTGCTTGCTCAAGGATGCGGAGTCG
AGGGTTTCGGACGATGCTGAGGTTTTGGCGCCTGAGGATGTCGTTCCGGTGCCTAGGCCGGCTTCCAGGGAGACG
GAGGCGGATAGGGTGGGGGATGTTACCAGGTTGGATAGGAAGCTTGATCGGACGCTCTATCTTGTTGTCAAGGGG
AACGAGGGATGGGGGTTTCCGGCTGGTGTCATGGGCAATGAGGAGAACCTCCACGAAGTTCGTTCCCCACCCCCC
CCTAAACAAGTCCACGATACTAACACACAACTCAGGCAGCGCGACGCGTCCTCGACACAGCAGCAGGCGTCGACA
TGAACACCTGGATAATAGGCCGCGTCCCCGTCGCCCACATCGTCGCCCCGCCCGTCGTCGACGCCAACGGCAGCA
TCCTCCAGCGCACGCGCAAGACCTTCTTCCTCAAGGCTCGCATCATCGCCGGCCAGGCTAACCTCTCTGATAACC
CCTTTGGCTTCACGCAGTTCAAGTGGCTCGTTAGGGAGGAGGTGGAGGAGGTGCTGGCGCCGGAGTACTTTCAGA
AAGTGCGCAATATGATGCCTGATCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail