Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3192
Gene name
LocationContig_284:3512..5671
Strand+
Gene length (bp)2159
Transcript length (bp)2079
Coding sequence length (bp)2079
Protein length (aa) 693

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00817 IMS impB/mucB/samB family 1.1E-42 40 267
PF11799 IMS_C impB/mucB/samB family C-terminal domain 1.9E-11 357 466
PF18439 zf_UBZ Ubiquitin-Binding Zinc Finger 3.5E-09 619 648

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42917|ESO1_SCHPO N-acetyltransferase eso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eso1 PE=1 SV=1 15 503 2.0E-92
sp|Q04049|POLH_YEAST DNA polymerase eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD30 PE=1 SV=1 15 465 4.0E-56
sp|Q9JJN0|POLH_MOUSE DNA polymerase eta OS=Mus musculus GN=Polh PE=1 SV=1 35 378 2.0E-44
sp|Q9Y253|POLH_HUMAN DNA polymerase eta OS=Homo sapiens GN=POLH PE=1 SV=1 35 393 5.0E-43
sp|Q8H2D5|POLH_ARATH DNA polymerase eta OS=Arabidopsis thaliana GN=POLH PE=1 SV=1 35 456 8.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42917|ESO1_SCHPO N-acetyltransferase eso1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=eso1 PE=1 SV=1 15 503 2.0E-92
sp|Q04049|POLH_YEAST DNA polymerase eta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD30 PE=1 SV=1 15 465 4.0E-56
sp|Q9JJN0|POLH_MOUSE DNA polymerase eta OS=Mus musculus GN=Polh PE=1 SV=1 35 378 2.0E-44
sp|Q9Y253|POLH_HUMAN DNA polymerase eta OS=Homo sapiens GN=POLH PE=1 SV=1 35 393 5.0E-43
sp|Q8H2D5|POLH_ARATH DNA polymerase eta OS=Arabidopsis thaliana GN=POLH PE=1 SV=1 35 456 8.0E-38
sp|Q6R3M4|POLI_MOUSE DNA polymerase iota OS=Mus musculus GN=Poli PE=1 SV=1 35 424 4.0E-28
sp|Q9UNA4|POLI_HUMAN DNA polymerase iota OS=Homo sapiens GN=POLI PE=1 SV=3 13 424 6.0E-28
sp|Q5WYY8|DPO4_LEGPL DNA polymerase IV OS=Legionella pneumophila (strain Lens) GN=dinB PE=3 SV=1 32 394 2.0E-20
sp|A5IH02|DPO4_LEGPC DNA polymerase IV OS=Legionella pneumophila (strain Corby) GN=dinB PE=3 SV=1 32 394 4.0E-20
sp|Q5X7J1|DPO4_LEGPA DNA polymerase IV OS=Legionella pneumophila (strain Paris) GN=dinB PE=3 SV=1 32 394 4.0E-20
sp|Q5ZY20|DPO4_LEGPH DNA polymerase IV OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dinB PE=3 SV=1 32 394 4.0E-20
sp|Q3BP42|DPO4_XANC5 DNA polymerase IV OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dinB PE=3 SV=1 217 365 6.0E-16
sp|Q8PGJ4|DPO4_XANAC DNA polymerase IV OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dinB PE=3 SV=1 217 365 7.0E-16
sp|Q8PCW8|DPO4_XANCP DNA polymerase IV OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dinB PE=3 SV=1 230 365 2.0E-15
sp|Q4UQI2|DPO4_XANC8 DNA polymerase IV OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dinB PE=3 SV=1 230 365 2.0E-15
sp|Q2P7M9|DPO4_XANOM DNA polymerase IV OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dinB PE=3 SV=1 217 365 5.0E-15
sp|B1YK83|DPO4_EXIS2 DNA polymerase IV OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dinB PE=3 SV=1 217 465 5.0E-15
sp|Q98NW7|DPO43_RHILO DNA polymerase IV 3 OS=Rhizobium loti (strain MAFF303099) GN=dinB3 PE=3 SV=1 233 446 9.0E-15
sp|A8H771|DPO4_SHEPA DNA polymerase IV OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dinB PE=3 SV=1 34 390 1.0E-14
sp|Q6GFG2|DPO4_STAAR DNA polymerase IV OS=Staphylococcus aureus (strain MRSA252) GN=dinB PE=3 SV=1 35 478 4.0E-13
sp|A0KTR5|DPO4_SHESA DNA polymerase IV OS=Shewanella sp. (strain ANA-3) GN=dinB PE=3 SV=1 34 390 8.0E-13
sp|P58965|DPO4_CALS4 DNA polymerase IV OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dinB PE=3 SV=1 35 393 8.0E-13
sp|Q4L7K8|DPO4_STAHJ DNA polymerase IV OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dinB PE=3 SV=1 35 478 1.0E-12
sp|P58964|DPO4_STAAW DNA polymerase IV OS=Staphylococcus aureus (strain MW2) GN=dinB PE=3 SV=1 35 478 2.0E-12
sp|Q6G838|DPO4_STAAS DNA polymerase IV OS=Staphylococcus aureus (strain MSSA476) GN=dinB PE=3 SV=1 35 478 2.0E-12
sp|A6QIC3|DPO4_STAAE DNA polymerase IV OS=Staphylococcus aureus (strain Newman) GN=dinB PE=3 SV=1 35 478 2.0E-12
sp|Q5HEM7|DPO4_STAAC DNA polymerase IV OS=Staphylococcus aureus (strain COL) GN=dinB PE=3 SV=1 35 478 2.0E-12
sp|B2UKN1|DPO4_AKKM8 DNA polymerase IV OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=dinB PE=3 SV=1 232 460 2.0E-12
sp|A5IU61|DPO4_STAA9 DNA polymerase IV OS=Staphylococcus aureus (strain JH9) GN=dinB PE=3 SV=1 35 478 2.0E-12
sp|A6U2Z9|DPO4_STAA2 DNA polymerase IV OS=Staphylococcus aureus (strain JH1) GN=dinB PE=3 SV=1 35 478 2.0E-12
sp|A8MGJ5|DPO4_ALKOO DNA polymerase IV OS=Alkaliphilus oremlandii (strain OhILAs) GN=dinB PE=3 SV=1 32 466 3.0E-12
sp|Q0HY21|DPO4_SHESR DNA polymerase IV OS=Shewanella sp. (strain MR-7) GN=dinB PE=3 SV=1 34 390 3.0E-12
sp|P63992|DPO4_STAAN DNA polymerase IV OS=Staphylococcus aureus (strain N315) GN=dinB PE=3 SV=1 35 478 3.0E-12
sp|P63991|DPO4_STAAM DNA polymerase IV OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dinB PE=3 SV=1 35 478 3.0E-12
sp|A7X420|DPO4_STAA1 DNA polymerase IV OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dinB PE=3 SV=1 35 478 3.0E-12
sp|Q0HLP0|DPO4_SHESM DNA polymerase IV OS=Shewanella sp. (strain MR-4) GN=dinB PE=3 SV=1 34 391 3.0E-12
sp|B9DMT3|DPO4_STACT DNA polymerase IV OS=Staphylococcus carnosus (strain TM300) GN=dinB PE=3 SV=1 35 478 5.0E-12
sp|Q65TG8|DPO4_MANSM DNA polymerase IV OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dinB PE=3 SV=1 32 376 6.0E-12
sp|A9A3A9|DPO4_NITMS DNA polymerase IV OS=Nitrosopumilus maritimus (strain SCM1) GN=dbh PE=3 SV=1 233 353 7.0E-12
sp|B8FBE8|DPO4_DESAA DNA polymerase IV OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dinB PE=3 SV=1 235 389 7.0E-12
sp|B2FLR2|DPO4_STRMK DNA polymerase IV OS=Stenotrophomonas maltophilia (strain K279a) GN=dinB PE=3 SV=1 232 365 8.0E-12
sp|B4SIF5|DPO4_STRM5 DNA polymerase IV OS=Stenotrophomonas maltophilia (strain R551-3) GN=dinB PE=3 SV=1 230 365 8.0E-12
sp|Q5M2Y5|DPO4_STRT2 DNA polymerase IV OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dinB PE=3 SV=1 35 365 1.0E-11
sp|B0TZS5|DPO4_FRAP2 DNA polymerase IV OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dinB PE=3 SV=1 233 441 2.0E-11
sp|Q6D1H8|DPO4_PECAS DNA polymerase IV OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dinB PE=3 SV=1 34 390 2.0E-11
sp|Q49YT9|DPO4_STAS1 DNA polymerase IV OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dinB PE=3 SV=1 35 478 2.0E-11
sp|Q8EHU9|DPO4_SHEON DNA polymerase IV OS=Shewanella oneidensis (strain MR-1) GN=dinB PE=3 SV=1 34 390 3.0E-11
sp|Q03J54|DPO4_STRTD DNA polymerase IV OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dinB PE=3 SV=1 35 365 3.0E-11
sp|A3CSG3|DPO4_METMJ DNA polymerase IV OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=dbh PE=3 SV=1 240 422 6.0E-11
sp|Q5LYC2|DPO4_STRT1 DNA polymerase IV OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dinB PE=3 SV=1 35 365 9.0E-11
sp|Q8EQ56|DPO4_OCEIH DNA polymerase IV OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dinB PE=3 SV=1 32 173 1.0E-10
sp|A0Q6K9|DPO4_FRATN DNA polymerase IV OS=Francisella tularensis subsp. novicida (strain U112) GN=dinB PE=3 SV=1 233 441 2.0E-10
sp|A8AUV7|DPO4_STRGC DNA polymerase IV OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dinB PE=3 SV=1 217 420 3.0E-10
sp|Q8UJK7|DPO42_AGRFC DNA polymerase IV 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dinB2 PE=3 SV=2 230 370 3.0E-10
sp|Q9CNG4|DPO4_PASMU DNA polymerase IV OS=Pasteurella multocida (strain Pm70) GN=dinB PE=3 SV=1 34 392 4.0E-10
sp|Q8DVR7|DPO4_STRMU DNA polymerase IV OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dinB PE=3 SV=1 35 365 4.0E-10
sp|Q2A3L2|DPO4_FRATH DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dinB PE=3 SV=1 233 441 4.0E-10
sp|A7NC07|DPO4_FRATF DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dinB PE=3 SV=1 233 441 4.0E-10
sp|Q0BM23|DPO4_FRATO DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dinB PE=3 SV=1 233 441 4.0E-10
sp|Q8PT42|DPO42_METMA DNA polymerase IV 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dbh2 PE=3 SV=1 30 391 4.0E-10
sp|Q8XZ19|DPO4_RALSO DNA polymerase IV OS=Ralstonia solanacearum (strain GMI1000) GN=dinB PE=3 SV=2 224 390 5.0E-10
sp|Q8DXW9|DPO4_STRA5 DNA polymerase IV OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dinB PE=3 SV=1 35 466 6.0E-10
sp|Q8E3I8|DPO4_STRA3 DNA polymerase IV OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dinB PE=3 SV=1 35 466 6.0E-10
sp|Q3JZG9|DPO4_STRA1 DNA polymerase IV OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dinB PE=3 SV=1 35 466 6.0E-10
sp|B2SH34|DPO4_FRATM DNA polymerase IV OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=dinB PE=3 SV=1 233 441 1.0E-09
sp|Q98LV1|DPO41_RHILO DNA polymerase IV 1 OS=Rhizobium loti (strain MAFF303099) GN=dinB1 PE=3 SV=1 37 420 2.0E-09
sp|Q18A91|DPO4_PEPD6 DNA polymerase IV OS=Peptoclostridium difficile (strain 630) GN=dinB PE=3 SV=1 235 377 3.0E-09
sp|Q5F8N2|DPO4_NEIG1 DNA polymerase IV OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dinB PE=3 SV=1 34 361 6.0E-09
sp|Q8PYH6|DPO41_METMA DNA polymerase IV 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dbh1 PE=3 SV=1 232 353 6.0E-09
sp|Q8NZI1|DPO4_STRP8 DNA polymerase IV OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dinB PE=3 SV=1 233 425 7.0E-09
sp|Q8TIW3|DPO4_METAC DNA polymerase IV OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dbh PE=3 SV=1 232 465 7.0E-09
sp|Q72MY7|DPO4_LEPIC DNA polymerase IV OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dinB PE=3 SV=2 201 365 8.0E-09
sp|Q1JF59|DPO4_STRPD DNA polymerase IV OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dinB PE=3 SV=1 233 425 8.0E-09
sp|Q48RJ4|DPO4_STRPM DNA polymerase IV OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dinB PE=3 SV=1 217 425 8.0E-09
sp|Q5XA48|DPO4_STRP6 DNA polymerase IV OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dinB PE=3 SV=1 217 425 9.0E-09
sp|A2RCQ1|DPO4_STRPG DNA polymerase IV OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dinB PE=3 SV=1 233 425 9.0E-09
sp|Q1JK63|DPO4_STRPC DNA polymerase IV OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dinB PE=3 SV=1 217 425 1.0E-08
sp|Q1JA16|DPO4_STRPB DNA polymerase IV OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=dinB PE=3 SV=1 217 425 1.0E-08
sp|Q8F8Q2|DPO4_LEPIN DNA polymerase IV OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dinB PE=3 SV=2 201 365 1.0E-08
sp|A1KUQ3|DPO4_NEIMF DNA polymerase IV OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dinB PE=3 SV=1 233 361 1.0E-08
sp|A3CKU4|DPO4_STRSV DNA polymerase IV OS=Streptococcus sanguinis (strain SK36) GN=dinB PE=3 SV=1 217 420 1.0E-08
sp|P0DA79|DPO4_STRPQ DNA polymerase IV OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dinB PE=3 SV=1 233 425 2.0E-08
sp|P0DA78|DPO4_STRP3 DNA polymerase IV OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dinB PE=3 SV=1 233 425 2.0E-08
sp|Q9JRG1|DPO4_NEIMA DNA polymerase IV OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dinB PE=3 SV=1 233 351 2.0E-08
sp|A0AK80|DPO4_LISW6 DNA polymerase IV OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dinB PE=3 SV=1 217 391 2.0E-08
sp|Q99Y66|DPO4_STRP1 DNA polymerase IV OS=Streptococcus pyogenes serotype M1 GN=dinB PE=3 SV=2 233 425 3.0E-08
sp|Q92A40|DPO4_LISIN DNA polymerase IV OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dinB PE=3 SV=1 217 391 3.0E-08
sp|Q1J509|DPO4_STRPF DNA polymerase IV OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dinB PE=3 SV=1 217 425 3.0E-08
sp|Q8NNP4|DPO4_CORGL DNA polymerase IV OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dinB PE=3 SV=1 35 419 4.0E-08
sp|A4QFK8|DPO4_CORGB DNA polymerase IV OS=Corynebacterium glutamicum (strain R) GN=dinB PE=3 SV=1 35 419 4.0E-08
sp|B8DBV7|DPO4_LISMH DNA polymerase IV OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dinB PE=3 SV=1 217 391 5.0E-08
sp|Q71Y46|DPO4_LISMF DNA polymerase IV OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dinB PE=3 SV=1 217 391 6.0E-08
sp|C1KWR9|DPO4_LISMC DNA polymerase IV OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dinB PE=3 SV=1 217 391 7.0E-08
sp|Q8Y5T0|DPO4_LISMO DNA polymerase IV OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dinB PE=3 SV=1 217 391 7.0E-08
sp|Q8DQZ7|DPO4_STRR6 DNA polymerase IV OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dinB PE=3 SV=2 217 416 1.0E-07
sp|Q04M21|DPO4_STRP2 DNA polymerase IV OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dinB PE=3 SV=1 217 416 1.0E-07
sp|Q97SC7|DPO4_STRPN DNA polymerase IV OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dinB PE=3 SV=2 217 416 1.0E-07
sp|A8FYV3|DPO4_SHESH DNA polymerase IV OS=Shewanella sediminis (strain HAW-EB3) GN=dinB PE=3 SV=1 233 446 1.0E-07
sp|B0TQD1|DPO4_SHEHH DNA polymerase IV OS=Shewanella halifaxensis (strain HAW-EB4) GN=dinB PE=3 SV=1 233 390 2.0E-07
sp|Q9JYS8|DPO4_NEIMB DNA polymerase IV OS=Neisseria meningitidis serogroup B (strain MC58) GN=dinB PE=3 SV=1 233 361 2.0E-07
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 206 414 2.0E-07
sp|B1ZN03|DPO4_OPITP DNA polymerase IV OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dinB PE=3 SV=1 235 412 2.0E-07
sp|Q0A4X2|DPO4_ALKEH DNA polymerase IV OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dinB PE=3 SV=1 35 395 2.0E-07
sp|Q8XK37|DPO4_CLOPE DNA polymerase IV OS=Clostridium perfringens (strain 13 / Type A) GN=dinB PE=3 SV=1 229 359 3.0E-07
sp|Q92XH8|DPO42_RHIME DNA polymerase IV 2 OS=Rhizobium meliloti (strain 1021) GN=dinB2 PE=3 SV=2 232 407 3.0E-07
sp|A5D243|DPO4_PELTS DNA polymerase IV OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=dinB PE=3 SV=1 224 352 3.0E-07
sp|Q0SSQ2|DPO4_CLOPS DNA polymerase IV OS=Clostridium perfringens (strain SM101 / Type A) GN=dinB PE=3 SV=1 233 359 3.0E-07
sp|Q0TQ38|DPO4_CLOP1 DNA polymerase IV OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dinB PE=3 SV=1 229 379 5.0E-07
sp|Q4KWZ7|REV1_CHICK DNA repair protein REV1 OS=Gallus gallus GN=REV1 PE=2 SV=1 206 413 5.0E-07
sp|Q6MA55|DPO4_PARUW DNA polymerase IV OS=Protochlamydia amoebophila (strain UWE25) GN=dinB PE=3 SV=1 233 373 6.0E-07
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 206 496 7.0E-07
sp|B1KD33|DPO4_SHEWM DNA polymerase IV OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dinB PE=3 SV=1 233 390 8.0E-07
sp|Q9HQT4|DPO4_HALSA DNA polymerase IV OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dbh PE=3 SV=2 35 442 9.0E-07
sp|B0R4P0|DPO4_HALS3 DNA polymerase IV OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dbh PE=3 SV=1 35 442 9.0E-07
sp|P9WNT3|DPO41_MYCTU DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dinB1 PE=1 SV=1 240 529 1.0E-06
sp|P9WNT2|DPO41_MYCTO DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dinB1 PE=3 SV=1 240 529 1.0E-06
sp|P63986|DPO41_MYCBO DNA polymerase IV 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dinB1 PE=3 SV=1 240 529 1.0E-06
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 206 414 1.0E-06
sp|Q3Z5A4|DPO4_SHISS DNA polymerase IV OS=Shigella sonnei (strain Ss046) GN=dinB PE=3 SV=1 233 359 2.0E-06
sp|Q47155|DPO4_ECOLI DNA polymerase IV OS=Escherichia coli (strain K12) GN=dinB PE=1 SV=1 233 359 2.0E-06
sp|B1J100|DPO4_ECOLC DNA polymerase IV OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dinB PE=3 SV=1 233 359 2.0E-06
sp|B2U3S3|DPO4_SHIB3 DNA polymerase IV OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dinB PE=3 SV=1 233 359 2.0E-06
sp|A7ZHZ2|DPO4_ECO24 DNA polymerase IV OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dinB PE=3 SV=1 233 359 2.0E-06
sp|Q1RFU0|DPO4_ECOUT DNA polymerase IV OS=Escherichia coli (strain UTI89 / UPEC) GN=dinB PE=3 SV=1 233 359 2.0E-06
sp|Q0TL85|DPO4_ECOL5 DNA polymerase IV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dinB PE=3 SV=1 233 359 2.0E-06
sp|A1A7U2|DPO4_ECOK1 DNA polymerase IV OS=Escherichia coli O1:K1 / APEC GN=dinB PE=3 SV=1 233 359 2.0E-06
sp|A0KHD5|DPO4_AERHH DNA polymerase IV OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dinB PE=3 SV=1 233 331 2.0E-06
sp|Q8X7Q1|DPO4_ECO57 DNA polymerase IV OS=Escherichia coli O157:H7 GN=dinB PE=3 SV=1 233 359 3.0E-06
sp|Q88V07|DPO4_LACPL DNA polymerase IV OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dinB PE=3 SV=2 233 410 3.0E-06
sp|P59477|DPO4_ECOL6 DNA polymerase IV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dinB PE=3 SV=1 233 359 3.0E-06
sp|Q32J17|DPO4_SHIDS DNA polymerase IV OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dinB PE=3 SV=1 233 359 3.0E-06
sp|A6WRW5|DPO4_SHEB8 DNA polymerase IV OS=Shewanella baltica (strain OS185) GN=dinB PE=3 SV=1 233 462 4.0E-06
sp|A3D147|DPO4_SHEB5 DNA polymerase IV OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dinB PE=3 SV=1 233 462 4.0E-06
sp|P58963|DPO4_ESCFE DNA polymerase IV (Fragment) OS=Escherichia fergusonii GN=dinB PE=3 SV=1 233 359 4.0E-06
sp|A1WY69|DPO4_HALHL DNA polymerase IV OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dinB PE=3 SV=1 233 365 4.0E-06
sp|A1U339|DPO4_MARHV DNA polymerase IV OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dinB PE=3 SV=1 233 394 4.0E-06
sp|A7ZWJ6|DPO4_ECOHS DNA polymerase IV OS=Escherichia coli O9:H4 (strain HS) GN=dinB PE=3 SV=1 233 359 4.0E-06
sp|Q7USY7|DPO4_RHOBA DNA polymerase IV OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dinB PE=3 SV=1 235 466 4.0E-06
sp|Q5PF76|DPO4_SALPA DNA polymerase IV OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dinB PE=3 SV=1 233 359 4.0E-06
sp|Q3ZWB2|DPO4_DEHMC DNA polymerase IV OS=Dehalococcoides mccartyi (strain CBDB1) GN=dinB PE=3 SV=1 234 434 5.0E-06
sp|A9L0T3|DPO4_SHEB9 DNA polymerase IV OS=Shewanella baltica (strain OS195) GN=dinB PE=3 SV=1 233 462 5.0E-06
sp|A4TPK8|DPO4_YERPP DNA polymerase IV OS=Yersinia pestis (strain Pestoides F) GN=dinB PE=3 SV=1 233 369 6.0E-06
sp|Q1CLD4|DPO4_YERPN DNA polymerase IV OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dinB PE=3 SV=1 233 369 6.0E-06
sp|Q8ZBZ9|DPO4_YERPE DNA polymerase IV OS=Yersinia pestis GN=dinB PE=3 SV=1 233 369 6.0E-06
sp|Q1C4D9|DPO4_YERPA DNA polymerase IV OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dinB PE=3 SV=1 233 369 6.0E-06
sp|Q57SU1|DPO4_SALCH DNA polymerase IV OS=Salmonella choleraesuis (strain SC-B67) GN=dinB PE=3 SV=1 233 359 6.0E-06
sp|A9MNS1|DPO4_SALAR DNA polymerase IV OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dinB PE=3 SV=1 233 359 8.0E-06
sp|A8GAC8|DPO4_SERP5 DNA polymerase IV OS=Serratia proteamaculans (strain 568) GN=dinB PE=3 SV=1 233 406 8.0E-06
sp|P63989|DPO4_SALTY DNA polymerase IV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dinB PE=3 SV=1 233 359 9.0E-06
sp|P63990|DPO4_SALTI DNA polymerase IV OS=Salmonella typhi GN=dinB PE=3 SV=1 233 359 9.0E-06
sp|A9MY13|DPO4_SALPB DNA polymerase IV OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dinB PE=3 SV=1 233 359 9.0E-06
sp|Q818U9|DPO4_BACCR DNA polymerase IV OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dinB PE=3 SV=1 235 390 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003684 damaged DNA binding Yes
GO:0006281 DNA repair Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0033554 cellular response to stress No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006950 response to stress No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3822
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|568
Ophiocordyceps australis map64 (Brazil) OphauB2|667
Ophiocordyceps camponoti-floridani Ophcf2|06117
Ophiocordyceps camponoti-rufipedis Ophun1|3192 (this protein)
Ophiocordyceps kimflemingae Ophio5|5866
Ophiocordyceps subramaniannii Hirsu2|7520

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3192
MPSPSPPPSPGRASSRFTYRQLSQLATFNASNPLRVIAHIDLDAFYAQCEMVRLGIPEDKPLAVQQWQGLIAVNY
PARDSGISRHCDVSEARKLCPDLIAQHVATWREGHDGWAYRPDAAASIASDKVSLDPYRLESRKILAVVKEMLPQ
NLQRVEKASIDEVFLDLSAHVHALLLERFSELARPPPYDDGSEKLPLPSVVALDWADDALVRLEDDDQETRDPDW
DDVAMLLASEVVRAVRAAIRRKLGYTCSAGVANNKLLSKLGSGFHKPNRQTVIRARAASAFLGPFRLAKLRSLGG
KLGDQVVSAFNAELVQDLRAVPLDQIKAKLGDETGLWLYKTLRGVDTSDVNPRTQIKSMLSAKSFRPSIDSPEQA
VKWLTIFVADIYARLVDEGVPDNKRRPRTMNLHHRAPAGQTRSRQGPIPQGKTLDRELLLHLARDLLGQAMADGT
VWPCANLSLSVGGFEDGIKGNLGIGAFLVKTTSDPSAASISLPSDSSPGAGSRQSKRPRIGDGGLHRFFAKNSSP
SASRAPNDQDQDRQREQGPTVTDGERRPVDGACSTDAAQQSHMLLKATRHDDAGYGSDNKYEYNDDDKDNDCHDS
DDKDKDDCNNRDNIDNALSCSRCSASFQDVTSLQSHEDWHLAKDLDDEESHRPVASQRPQPSRGSLSKRTGPGPR
RGRGGKLEPGQTRLDFG*
Coding >Ophun1|3192
ATGCCGTCGCCATCGCCTCCGCCATCTCCAGGCCGCGCCTCCTCTCGCTTCACTTACCGACAGCTCTCGCAGCTC
GCCACCTTCAACGCGTCCAACCCGTTGCGCGTCATCGCCCACATCGACCTCGATGCCTTCTACGCTCAGTGCGAG
ATGGTTCGCCTTGGGATCCCCGAGGATAAGCCGCTCGCCGTTCAGCAGTGGCAAGGCCTCATCGCTGTCAACTAC
CCGGCGCGAGACTCTGGAATTAGCCGCCATTGTGATGTCTCCGAGGCGCGCAAGCTTTGCCCTGATCTGATTGCT
CAGCATGTGGCCACCTGGCGCGAAGGCCACGACGGCTGGGCCTATCGTCCTGACGCCGCTGCCAGTATCGCATCG
GACAAGGTCTCGCTAGACCCCTACCGACTCGAATCGCGAAAGATCCTGGCCGTTGTCAAGGAGATGCTGCCGCAG
AACCTGCAGAGGGTGGAAAAGGCCAGCATCGACGAGGTCTTCCTCGACCTATCTGCCCACGTTCACGCCTTGCTC
CTCGAACGCTTCTCCGAGCTCGCTCGTCCCCCGCCTTACGACGATGGTTCTGAGAAACTCCCGCTACCATCCGTC
GTCGCTCTCGACTGGGCCGACGATGCTCTGGTCCGTCTCGAAGACGATGACCAAGAGACCCGCGACCCCGACTGG
GATGACGTTGCCATGCTGCTGGCATCTGAAGTCGTGCGAGCCGTCCGCGCCGCCATACGCCGCAAGCTTGGCTAC
ACCTGCTCAGCCGGAGTGGCCAACAACAAGCTGCTGAGCAAGCTGGGTTCCGGCTTTCACAAGCCCAACAGACAG
ACCGTCATCCGCGCTCGTGCCGCCAGCGCCTTTCTCGGTCCCTTCCGCCTCGCCAAGCTACGCAGCCTGGGTGGC
AAGCTGGGTGACCAGGTCGTGTCGGCCTTCAACGCCGAGCTCGTTCAAGACCTGCGCGCCGTGCCGCTAGACCAG
ATCAAGGCCAAGCTAGGCGATGAGACGGGGCTATGGCTGTACAAGACGCTCCGTGGCGTTGATACCAGCGACGTC
AACCCGCGCACCCAGATCAAGTCGATGCTCTCGGCCAAGTCGTTTCGTCCCTCCATCGACAGCCCTGAACAGGCC
GTCAAATGGCTGACCATTTTCGTCGCCGACATCTACGCTCGCCTGGTCGACGAGGGCGTCCCGGACAACAAGCGG
AGGCCGCGCACCATGAACCTGCATCATCGCGCACCCGCAGGCCAGACGCGCAGCCGTCAAGGCCCGATCCCGCAG
GGAAAGACACTTGACAGGGAGTTGCTGCTCCATCTCGCCAGGGACCTGCTTGGGCAGGCCATGGCCGACGGCACC
GTCTGGCCGTGTGCCAACTTGAGCCTCAGCGTTGGTGGCTTCGAGGACGGCATCAAGGGAAATTTGGGCATCGGT
GCCTTTCTCGTCAAGACGACGTCTGACCCGTCTGCCGCCTCCATCTCTCTGCCATCCGACTCCTCCCCAGGGGCC
GGGTCGCGGCAGAGTAAGAGACCTCGTATCGGCGACGGCGGCCTACATCGATTCTTTGCCAAGAACTCGTCTCCC
TCTGCCAGCCGCGCGCCCAATGATCAAGACCAAGACCGACAACGAGAACAAGGCCCGACCGTAACGGACGGCGAG
CGGCGACCCGTCGACGGTGCCTGCTCGACGGATGCGGCGCAACAGTCACACATGTTGTTAAAGGCGACTCGACAT
GACGACGCCGGCTACGGCAGCGACAACAAGTACGAATACAACGACGACGATAAGGACAACGACTGCCACGACAGC
GACGACAAGGACAAAGACGACTGCAACAATAGAGACAACATAGACAACGCCCTGAGCTGCTCGCGATGCTCGGCC
TCTTTCCAGGACGTGACATCGCTGCAAAGCCACGAGGACTGGCACCTTGCCAAGGACCTAGATGACGAAGAGAGC
CACCGACCCGTCGCCTCGCAGAGGCCGCAACCCTCACGCGGCTCCCTTTCCAAACGGACGGGTCCTGGCCCGAGG
CGTGGTCGAGGTGGCAAACTTGAGCCTGGCCAAACAAGACTCGACTTTGGCTGA
Transcript >Ophun1|3192
ATGCCGTCGCCATCGCCTCCGCCATCTCCAGGCCGCGCCTCCTCTCGCTTCACTTACCGACAGCTCTCGCAGCTC
GCCACCTTCAACGCGTCCAACCCGTTGCGCGTCATCGCCCACATCGACCTCGATGCCTTCTACGCTCAGTGCGAG
ATGGTTCGCCTTGGGATCCCCGAGGATAAGCCGCTCGCCGTTCAGCAGTGGCAAGGCCTCATCGCTGTCAACTAC
CCGGCGCGAGACTCTGGAATTAGCCGCCATTGTGATGTCTCCGAGGCGCGCAAGCTTTGCCCTGATCTGATTGCT
CAGCATGTGGCCACCTGGCGCGAAGGCCACGACGGCTGGGCCTATCGTCCTGACGCCGCTGCCAGTATCGCATCG
GACAAGGTCTCGCTAGACCCCTACCGACTCGAATCGCGAAAGATCCTGGCCGTTGTCAAGGAGATGCTGCCGCAG
AACCTGCAGAGGGTGGAAAAGGCCAGCATCGACGAGGTCTTCCTCGACCTATCTGCCCACGTTCACGCCTTGCTC
CTCGAACGCTTCTCCGAGCTCGCTCGTCCCCCGCCTTACGACGATGGTTCTGAGAAACTCCCGCTACCATCCGTC
GTCGCTCTCGACTGGGCCGACGATGCTCTGGTCCGTCTCGAAGACGATGACCAAGAGACCCGCGACCCCGACTGG
GATGACGTTGCCATGCTGCTGGCATCTGAAGTCGTGCGAGCCGTCCGCGCCGCCATACGCCGCAAGCTTGGCTAC
ACCTGCTCAGCCGGAGTGGCCAACAACAAGCTGCTGAGCAAGCTGGGTTCCGGCTTTCACAAGCCCAACAGACAG
ACCGTCATCCGCGCTCGTGCCGCCAGCGCCTTTCTCGGTCCCTTCCGCCTCGCCAAGCTACGCAGCCTGGGTGGC
AAGCTGGGTGACCAGGTCGTGTCGGCCTTCAACGCCGAGCTCGTTCAAGACCTGCGCGCCGTGCCGCTAGACCAG
ATCAAGGCCAAGCTAGGCGATGAGACGGGGCTATGGCTGTACAAGACGCTCCGTGGCGTTGATACCAGCGACGTC
AACCCGCGCACCCAGATCAAGTCGATGCTCTCGGCCAAGTCGTTTCGTCCCTCCATCGACAGCCCTGAACAGGCC
GTCAAATGGCTGACCATTTTCGTCGCCGACATCTACGCTCGCCTGGTCGACGAGGGCGTCCCGGACAACAAGCGG
AGGCCGCGCACCATGAACCTGCATCATCGCGCACCCGCAGGCCAGACGCGCAGCCGTCAAGGCCCGATCCCGCAG
GGAAAGACACTTGACAGGGAGTTGCTGCTCCATCTCGCCAGGGACCTGCTTGGGCAGGCCATGGCCGACGGCACC
GTCTGGCCGTGTGCCAACTTGAGCCTCAGCGTTGGTGGCTTCGAGGACGGCATCAAGGGAAATTTGGGCATCGGT
GCCTTTCTCGTCAAGACGACGTCTGACCCGTCTGCCGCCTCCATCTCTCTGCCATCCGACTCCTCCCCAGGGGCC
GGGTCGCGGCAGAGTAAGAGACCTCGTATCGGCGACGGCGGCCTACATCGATTCTTTGCCAAGAACTCGTCTCCC
TCTGCCAGCCGCGCGCCCAATGATCAAGACCAAGACCGACAACGAGAACAAGGCCCGACCGTAACGGACGGCGAG
CGGCGACCCGTCGACGGTGCCTGCTCGACGGATGCGGCGCAACAGTCACACATGTTGTTAAAGGCGACTCGACAT
GACGACGCCGGCTACGGCAGCGACAACAAGTACGAATACAACGACGACGATAAGGACAACGACTGCCACGACAGC
GACGACAAGGACAAAGACGACTGCAACAATAGAGACAACATAGACAACGCCCTGAGCTGCTCGCGATGCTCGGCC
TCTTTCCAGGACGTGACATCGCTGCAAAGCCACGAGGACTGGCACCTTGCCAAGGACCTAGATGACGAAGAGAGC
CACCGACCCGTCGCCTCGCAGAGGCCGCAACCCTCACGCGGCTCCCTTTCCAAACGGACGGGTCCTGGCCCGAGG
CGTGGTCGAGGTGGCAAACTTGAGCCTGGCCAAACAAGACTCGACTTTGGCTGA
Gene >Ophun1|3192
ATGCCGTCGCCATCGCCTCCGCCATCTCCAGGCCGCGCCTCCTCTCGCTTCACTTACCGACAGCTCTCGCAGCTC
GCCACCTTCAACGCGTCCAACCCGTTGCGCGTCATCGCCCACATCGACCTCGATGCCTTCTACGCTCAGTGCGAG
ATGGTTCGCCTTGGGATCCCCGAGGATAAGCCGCTCGCCGTTCAGCAGTGGTGAGGCACGTTGCCGTCGTCGTCG
TCTGTTTGCGGCTTGACCTCTGTTCTGCTTCTCTCTAACGTTGCTGTCGACATAGGCAAGGCCTCATCGCTGTCA
ACTACCCGGCGCGAGACTCTGGAATTAGCCGCCATTGTGATGTCTCCGAGGCGCGCAAGCTTTGCCCTGATCTGA
TTGCTCAGCATGTGGCCACCTGGCGCGAAGGCCACGACGGCTGGGCCTATCGTCCTGACGCCGCTGCCAGTATCG
CATCGGACAAGGTCTCGCTAGACCCCTACCGACTCGAATCGCGAAAGATCCTGGCCGTTGTCAAGGAGATGCTGC
CGCAGAACCTGCAGAGGGTGGAAAAGGCCAGCATCGACGAGGTCTTCCTCGACCTATCTGCCCACGTTCACGCCT
TGCTCCTCGAACGCTTCTCCGAGCTCGCTCGTCCCCCGCCTTACGACGATGGTTCTGAGAAACTCCCGCTACCAT
CCGTCGTCGCTCTCGACTGGGCCGACGATGCTCTGGTCCGTCTCGAAGACGATGACCAAGAGACCCGCGACCCCG
ACTGGGATGACGTTGCCATGCTGCTGGCATCTGAAGTCGTGCGAGCCGTCCGCGCCGCCATACGCCGCAAGCTTG
GCTACACCTGCTCAGCCGGAGTGGCCAACAACAAGCTGCTGAGCAAGCTGGGTTCCGGCTTTCACAAGCCCAACA
GACAGACCGTCATCCGCGCTCGTGCCGCCAGCGCCTTTCTCGGTCCCTTCCGCCTCGCCAAGCTACGCAGCCTGG
GTGGCAAGCTGGGTGACCAGGTCGTGTCGGCCTTCAACGCCGAGCTCGTTCAAGACCTGCGCGCCGTGCCGCTAG
ACCAGATCAAGGCCAAGCTAGGCGATGAGACGGGGCTATGGCTGTACAAGACGCTCCGTGGCGTTGATACCAGCG
ACGTCAACCCGCGCACCCAGATCAAGTCGATGCTCTCGGCCAAGTCGTTTCGTCCCTCCATCGACAGCCCTGAAC
AGGCCGTCAAATGGCTGACCATTTTCGTCGCCGACATCTACGCTCGCCTGGTCGACGAGGGCGTCCCGGACAACA
AGCGGAGGCCGCGCACCATGAACCTGCATCATCGCGCACCCGCAGGCCAGACGCGCAGCCGTCAAGGCCCGATCC
CGCAGGGAAAGACACTTGACAGGGAGTTGCTGCTCCATCTCGCCAGGGACCTGCTTGGGCAGGCCATGGCCGACG
GCACCGTCTGGCCGTGTGCCAACTTGAGCCTCAGCGTTGGTGGCTTCGAGGACGGCATCAAGGGAAATTTGGGCA
TCGGTGCCTTTCTCGTCAAGACGACGTCTGACCCGTCTGCCGCCTCCATCTCTCTGCCATCCGACTCCTCCCCAG
GGGCCGGGTCGCGGCAGAGTAAGAGACCTCGTATCGGCGACGGCGGCCTACATCGATTCTTTGCCAAGAACTCGT
CTCCCTCTGCCAGCCGCGCGCCCAATGATCAAGACCAAGACCGACAACGAGAACAAGGCCCGACCGTAACGGACG
GCGAGCGGCGACCCGTCGACGGTGCCTGCTCGACGGATGCGGCGCAACAGTCACACATGTTGTTAAAGGCGACTC
GACATGACGACGCCGGCTACGGCAGCGACAACAAGTACGAATACAACGACGACGATAAGGACAACGACTGCCACG
ACAGCGACGACAAGGACAAAGACGACTGCAACAATAGAGACAACATAGACAACGCCCTGAGCTGCTCGCGATGCT
CGGCCTCTTTCCAGGACGTGACATCGCTGCAAAGCCACGAGGACTGGCACCTTGCCAAGGACCTAGATGACGAAG
AGAGCCACCGACCCGTCGCCTCGCAGAGGCCGCAACCCTCACGCGGCTCCCTTTCCAAACGGACGGGTCCTGGCC
CGAGGCGTGGTCGAGGTGGCAAACTTGAGCCTGGCCAAACAAGACTCGACTTTGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail