Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3186
Gene name
LocationContig_283:12191..15146
Strand-
Gene length (bp)2955
Transcript length (bp)2904
Coding sequence length (bp)2904
Protein length (aa) 968

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13855 LRR_8 Leucine rich repeat 3.2E-07 420 479
PF13516 LRR_6 Leucine Rich repeat 5.2E-01 419 434

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 298 947 2.0E-39
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 300 947 8.0E-35
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 300 947 1.0E-34
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 312 947 4.0E-34
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 286 947 1.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZLN0|LRC40_CHICK Leucine-rich repeat-containing protein 40 OS=Gallus gallus GN=LRRC40 PE=2 SV=1 298 947 2.0E-39
sp|Q4R3P6|LRC40_MACFA Leucine-rich repeat-containing protein 40 OS=Macaca fascicularis GN=LRRC40 PE=2 SV=1 300 947 8.0E-35
sp|Q9H9A6|LRC40_HUMAN Leucine-rich repeat-containing protein 40 OS=Homo sapiens GN=LRRC40 PE=1 SV=1 300 947 1.0E-34
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 312 947 4.0E-34
sp|Q5RFE9|LRC40_PONAB Leucine-rich repeat-containing protein 40 OS=Pongo abelii GN=LRRC40 PE=2 SV=1 286 947 1.0E-33
sp|Q9CRC8|LRC40_MOUSE Leucine-rich repeat-containing protein 40 OS=Mus musculus GN=Lrrc40 PE=1 SV=2 285 947 9.0E-33
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 312 947 1.0E-32
sp|Q7SXW3|LRC40_DANRE Leucine-rich repeat-containing protein 40 OS=Danio rerio GN=lrrc40 PE=2 SV=1 299 947 2.0E-30
sp|Q6K7R2|PIRL6_ORYSJ Plant intracellular Ras-group-related LRR protein 6 OS=Oryza sativa subsp. japonica GN=IRL6 PE=2 SV=1 308 949 4.0E-26
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 398 903 6.0E-18
sp|Q96RT1|LAP2_HUMAN Protein LAP2 OS=Homo sapiens GN=ERBB2IP PE=1 SV=2 306 644 2.0E-16
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 306 644 2.0E-15
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 306 664 2.0E-15
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 397 644 2.0E-15
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 306 664 3.0E-15
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 280 641 3.0E-15
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 306 664 3.0E-15
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 398 643 7.0E-15
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 391 643 8.0E-15
sp|Q96NW7|LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens GN=LRRC7 PE=1 SV=1 280 641 2.0E-14
sp|F1MCA7|LRRC7_BOVIN Leucine-rich repeat-containing protein 7 OS=Bos taurus GN=LRRC7 PE=3 SV=3 308 664 2.0E-14
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 295 641 2.0E-14
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 356 648 3.0E-14
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 280 641 4.0E-14
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 280 641 4.0E-14
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 398 644 4.0E-14
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 385 677 5.0E-14
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 464 633 7.0E-14
sp|Q80TE7|LRRC7_MOUSE Leucine-rich repeat-containing protein 7 OS=Mus musculus GN=Lrrc7 PE=1 SV=2 311 643 2.0E-13
sp|P70587|LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus GN=Lrrc7 PE=1 SV=2 311 643 2.0E-13
sp|Q9LRV8|PIRL2_ARATH Plant intracellular Ras-group-related LRR protein 2 OS=Arabidopsis thaliana GN=PIRL2 PE=2 SV=1 391 631 2.0E-13
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 397 923 2.0E-13
sp|Q940E8|FEA2_MAIZE Leucine-rich repeat receptor-like protein FASCIATED EAR2 OS=Zea mays GN=FEA2 PE=1 SV=1 398 648 3.0E-13
sp|O64566|PIRL6_ARATH Plant intracellular Ras-group-related LRR protein 6 OS=Arabidopsis thaliana GN=PIRL6 PE=2 SV=1 439 644 3.0E-13
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 393 643 3.0E-13
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 398 645 3.0E-13
sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 393 643 5.0E-13
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 397 922 6.0E-13
sp|Q3UGP9|LRC58_MOUSE Leucine-rich repeat-containing protein 58 OS=Mus musculus GN=Lrrc58 PE=2 SV=1 469 654 7.0E-13
sp|Q9SVW8|PIRL4_ARATH Plant intracellular Ras-group-related LRR protein 4 OS=Arabidopsis thaliana GN=PIRL4 PE=1 SV=1 389 643 8.0E-13
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 464 905 1.0E-12
sp|Q15404|RSU1_HUMAN Ras suppressor protein 1 OS=Homo sapiens GN=RSU1 PE=1 SV=3 428 644 2.0E-12
sp|Q96CX6|LRC58_HUMAN Leucine-rich repeat-containing protein 58 OS=Homo sapiens GN=LRRC58 PE=1 SV=2 469 654 2.0E-12
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 464 921 2.0E-12
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 464 633 3.0E-12
sp|A4IIK1|MFHA1_XENTR Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Xenopus tropicalis GN=mfhas1 PE=2 SV=1 385 641 3.0E-12
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 401 630 3.0E-12
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 393 643 3.0E-12
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 463 681 4.0E-12
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 390 674 4.0E-12
sp|Q9V780|LAP1_DROME Protein lap1 OS=Drosophila melanogaster GN=Lap1 PE=2 SV=1 390 653 4.0E-12
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 355 648 4.0E-12
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 393 652 4.0E-12
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 390 646 5.0E-12
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 398 669 5.0E-12
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 437 648 6.0E-12
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 390 674 6.0E-12
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 390 674 6.0E-12
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 390 674 8.0E-12
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 397 956 1.0E-11
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 398 641 1.0E-11
sp|C0LGP4|Y3475_ARATH Probable LRR receptor-like serine/threonine-protein kinase At3g47570 OS=Arabidopsis thaliana GN=At3g47570 PE=2 SV=1 398 641 1.0E-11
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 328 674 1.0E-11
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 406 644 1.0E-11
sp|A6H6A4|LRIQ4_MOUSE Leucine-rich repeat and IQ domain-containing protein 4 OS=Mus musculus GN=Lrriq4 PE=2 SV=1 408 656 1.0E-11
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 355 648 1.0E-11
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 290 630 1.0E-11
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 397 951 1.0E-11
sp|B4JTV9|SUR8_DROGR Leucine-rich repeat protein soc-2 homolog OS=Drosophila grimshawi GN=Sur-8 PE=3 SV=1 328 674 1.0E-11
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 428 630 1.0E-11
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 398 652 2.0E-11
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 398 643 2.0E-11
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 464 921 2.0E-11
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 357 643 2.0E-11
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 464 921 2.0E-11
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 464 921 2.0E-11
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 466 643 3.0E-11
sp|B3P3E8|SUR8_DROER Leucine-rich repeat protein soc-2 homolog OS=Drosophila erecta GN=Sur-8 PE=3 SV=1 464 951 3.0E-11
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 398 714 3.0E-11
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 401 624 3.0E-11
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 404 602 3.0E-11
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 420 641 3.0E-11
sp|Q9M0G7|PXL2_ARATH Leucine-rich repeat receptor-like protein kinase PXL2 OS=Arabidopsis thaliana GN=PXL2 PE=2 SV=1 393 655 3.0E-11
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 344 641 3.0E-11
sp|Q9VEK6|SUR8_DROME Leucine-rich repeat protein soc-2 homolog OS=Drosophila melanogaster GN=Sur-8 PE=2 SV=3 464 951 4.0E-11
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 464 921 4.0E-11
sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 321 642 4.0E-11
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 398 853 4.0E-11
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 390 674 4.0E-11
sp|B4LXW1|SUR8_DROVI Leucine-rich repeat protein soc-2 homolog OS=Drosophila virilis GN=Sur-8 PE=3 SV=1 397 951 5.0E-11
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 397 641 5.0E-11
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 464 921 5.0E-11
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 393 643 5.0E-11
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 398 897 6.0E-11
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 321 644 6.0E-11
sp|Q8C0R9|LRRD1_MOUSE Leucine-rich repeat and death domain-containing protein 1 OS=Mus musculus GN=Lrrd1 PE=2 SV=2 321 905 6.0E-11
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 464 951 7.0E-11
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 398 665 9.0E-11
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 398 670 9.0E-11
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 397 665 1.0E-10
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 464 951 1.0E-10
sp|Q5G5D8|PIRL7_ARATH Plant intracellular Ras-group-related LRR protein 7 OS=Arabidopsis thaliana GN=PIRL7 PE=2 SV=1 442 664 1.0E-10
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 464 643 1.0E-10
sp|Q9HBX8|LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens GN=LGR6 PE=1 SV=3 398 701 1.0E-10
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 397 951 1.0E-10
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 465 643 1.0E-10
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 432 902 2.0E-10
sp|Q01631|CYAA_NEUCR Adenylate cyclase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cr-1 PE=1 SV=2 393 629 2.0E-10
sp|B4QVR7|SUR8_DROSI Leucine-rich repeat protein soc-2 homolog OS=Drosophila simulans GN=Sur-8 PE=3 SV=2 398 956 2.0E-10
sp|Q7KRY7|LAP4_DROME Protein lap4 OS=Drosophila melanogaster GN=scrib PE=1 SV=1 452 643 2.0E-10
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 420 624 2.0E-10
sp|Q9SD62|Y3471_ARATH Putative receptor-like protein kinase At3g47110 OS=Arabidopsis thaliana GN=At3g47110 PE=3 SV=1 398 609 2.0E-10
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 468 643 2.0E-10
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 439 643 2.0E-10
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 331 641 2.0E-10
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 401 670 2.0E-10
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 437 692 2.0E-10
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 469 633 2.0E-10
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 321 644 2.0E-10
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 398 628 2.0E-10
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 393 642 3.0E-10
sp|Q14160|SCRIB_HUMAN Protein scribble homolog OS=Homo sapiens GN=SCRIB PE=1 SV=4 468 643 3.0E-10
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 398 947 3.0E-10
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 469 633 3.0E-10
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 398 641 3.0E-10
sp|Q921G6|LRCH4_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Mus musculus GN=Lrch4 PE=1 SV=1 312 550 4.0E-10
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 328 643 4.0E-10
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 398 658 4.0E-10
sp|Q80U72|SCRIB_MOUSE Protein scribble homolog OS=Mus musculus GN=Scrib PE=1 SV=2 468 643 4.0E-10
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 382 923 4.0E-10
sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 395 643 4.0E-10
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 401 626 4.0E-10
sp|Q8VYG9|PIRL9_ARATH Plant intracellular Ras-group-related LRR protein 9 OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1 401 631 4.0E-10
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 393 641 4.0E-10
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 468 643 4.0E-10
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 396 645 4.0E-10
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 448 902 5.0E-10
sp|B5DX45|SUR8_DROPS Leucine-rich repeat protein soc-2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Sur-8 PE=3 SV=1 390 646 5.0E-10
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 404 642 5.0E-10
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 450 643 5.0E-10
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 356 643 5.0E-10
sp|O75427|LRCH4_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens GN=LRCH4 PE=1 SV=2 312 550 6.0E-10
sp|Q4R6F0|LRRD1_MACFA Leucine-rich repeat and death domain-containing protein 1 OS=Macaca fascicularis GN=LRRD1 PE=2 SV=1 400 643 6.0E-10
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 420 624 6.0E-10
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 398 643 6.0E-10
sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 321 645 6.0E-10
sp|Q99467|CD180_HUMAN CD180 antigen OS=Homo sapiens GN=CD180 PE=1 SV=2 341 618 8.0E-10
sp|Q5G5E0|PIRL5_ARATH Plant intracellular Ras-group-related LRR protein 5 OS=Arabidopsis thaliana GN=PIRL5 PE=2 SV=1 391 643 8.0E-10
sp|Q55CS7|MPL1_DICDI MAP kinase phosphatase with leucine-rich repeats protein 1 OS=Dictyostelium discoideum GN=mpl1 PE=2 SV=1 398 623 8.0E-10
sp|Q9Y4C4|MFHA1_HUMAN Malignant fibrous histiocytoma-amplified sequence 1 OS=Homo sapiens GN=MFHAS1 PE=1 SV=2 398 631 9.0E-10
sp|B4N9T4|SUR8_DROWI Leucine-rich repeat protein soc-2 homolog OS=Drosophila willistoni GN=Sur-8 PE=3 SV=1 390 646 9.0E-10
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 405 641 9.0E-10
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 398 643 1.0E-09
sp|Q8RWE5|PIRL8_ARATH Plant intracellular Ras-group-related LRR protein 8 OS=Arabidopsis thaliana GN=PIRL8 PE=2 SV=1 442 660 1.0E-09
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 353 642 1.0E-09
sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 314 644 1.0E-09
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 328 636 1.0E-09
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 403 898 1.0E-09
sp|Q6ZVD8|PHLP2_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Homo sapiens GN=PHLPP2 PE=1 SV=3 298 630 1.0E-09
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 398 645 2.0E-09
sp|B3LWU3|SUR8_DROAN Leucine-rich repeat protein soc-2 homolog OS=Drosophila ananassae GN=Sur-8 PE=3 SV=1 464 951 2.0E-09
sp|A4D1F6|LRRD1_HUMAN Leucine-rich repeat and death domain-containing protein 1 OS=Homo sapiens GN=LRRD1 PE=2 SV=2 400 643 2.0E-09
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 398 643 2.0E-09
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 398 630 2.0E-09
sp|Q9C9H7|RLP12_ARATH Receptor-like protein 12 OS=Arabidopsis thaliana GN=RLP12 PE=2 SV=2 398 643 2.0E-09
sp|O88280|SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus GN=Slit3 PE=2 SV=1 321 645 2.0E-09
sp|Q01730|RSU1_MOUSE Ras suppressor protein 1 OS=Mus musculus GN=Rsu1 PE=1 SV=3 428 644 2.0E-09
sp|Q9FFJ3|PIRL1_ARATH Plant intracellular Ras-group-related LRR protein 1 OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1 398 631 2.0E-09
sp|Q6INV3|LRC57_XENLA Leucine-rich repeat-containing protein 57 OS=Xenopus laevis GN=lrrc57 PE=2 SV=1 420 648 2.0E-09
sp|Q8AVI4|SHOC2_XENLA Leucine-rich repeat protein SHOC-2 OS=Xenopus laevis GN=shoc2 PE=2 SV=1 262 643 3.0E-09
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 405 630 3.0E-09
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 390 631 3.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 398 643 3.0E-09
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 398 643 3.0E-09
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 403 584 3.0E-09
sp|Q9FII5|TDR_ARATH Leucine-rich repeat receptor-like protein kinase TDR OS=Arabidopsis thaliana GN=TDR PE=1 SV=1 301 641 3.0E-09
sp|Q55FD8|GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum GN=gefV PE=2 SV=1 356 649 3.0E-09
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 412 645 3.0E-09
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 415 923 4.0E-09
sp|Q7XNY1|PIRL1_ORYSJ Plant intracellular Ras-group-related LRR protein 1 OS=Oryza sativa subsp. japonica GN=IRL1 PE=2 SV=2 401 676 4.0E-09
sp|Q8GUQ5|BRI1_SOLLC Brassinosteroid LRR receptor kinase OS=Solanum lycopersicum GN=CURL3 PE=1 SV=1 395 643 4.0E-09
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 543 654 4.0E-09
sp|Q3ZC49|LRC39_BOVIN Leucine-rich repeat-containing protein 39 OS=Bos taurus GN=LRRC39 PE=2 SV=1 465 643 5.0E-09
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 445 641 5.0E-09
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 404 642 5.0E-09
sp|P02750|A2GL_HUMAN Leucine-rich alpha-2-glycoprotein OS=Homo sapiens GN=LRG1 PE=1 SV=2 781 925 5.0E-09
sp|Q1ZXD6|ROCO5_DICDI Probable serine/threonine-protein kinase roco5 OS=Dictyostelium discoideum GN=roco5 PE=3 SV=1 406 643 5.0E-09
sp|Q55E58|PATS1_DICDI Probable serine/threonine-protein kinase pats1 OS=Dictyostelium discoideum GN=pats1 PE=3 SV=1 398 643 6.0E-09
sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 357 642 8.0E-09
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 398 642 8.0E-09
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 393 643 8.0E-09
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 463 921 9.0E-09
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 393 805 9.0E-09
sp|Q38SD2|LRRK1_HUMAN Leucine-rich repeat serine/threonine-protein kinase 1 OS=Homo sapiens GN=LRRK1 PE=1 SV=3 401 643 9.0E-09
sp|Q9RBS2|POPC_RALSO Protein PopC OS=Ralstonia solanacearum (strain GMI1000) GN=popC PE=4 SV=2 398 642 1.0E-08
sp|P0DL10|TD1_MAIZE Leucine-rich repeat receptor-like kinase protein THICK TASSEL DWARF1 OS=Zea mays GN=TD1 PE=2 SV=1 424 555 1.0E-08
sp|Q01513|CYAA_PODAS Adenylate cyclase OS=Podospora anserina PE=3 SV=1 401 620 1.0E-08
sp|Q9BTT6|LRRC1_HUMAN Leucine-rich repeat-containing protein 1 OS=Homo sapiens GN=LRRC1 PE=1 SV=1 315 644 1.0E-08
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 466 642 1.0E-08
sp|Q9FL51|Y5694_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940 OS=Arabidopsis thaliana GN=At5g06940 PE=3 SV=1 398 618 1.0E-08
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 421 643 1.0E-08
sp|C0LGG8|Y5343_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g53430 OS=Arabidopsis thaliana GN=At1g53430 PE=1 SV=1 393 643 1.0E-08
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 400 641 1.0E-08
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 479 659 1.0E-08
sp|Q5M8G4|LRC40_XENTR Leucine-rich repeat-containing protein 40 OS=Xenopus tropicalis GN=lrrc40 PE=2 SV=1 760 962 2.0E-08
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 398 646 2.0E-08
sp|Q940E8|FEA2_MAIZE Leucine-rich repeat receptor-like protein FASCIATED EAR2 OS=Zea mays GN=FEA2 PE=1 SV=1 406 656 2.0E-08
sp|Q5F4C4|SHOC2_CHICK Leucine-rich repeat protein SHOC-2 OS=Gallus gallus GN=SHOC2 PE=2 SV=1 377 630 2.0E-08
sp|B4IBI9|SUR8_DROSE Leucine-rich repeat protein soc-2 homolog OS=Drosophila sechellia GN=Sur-8 PE=3 SV=1 303 643 2.0E-08
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 461 643 2.0E-08
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 276 643 2.0E-08
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 418 643 2.0E-08
sp|C0LGK9|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1 455 620 2.0E-08
sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=2 SV=1 398 643 2.0E-08
sp|C0LGR3|Y4265_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g26540 OS=Arabidopsis thaliana GN=At4g26540 PE=2 SV=1 393 641 2.0E-08
sp|Q3UHC2|LRRK1_MOUSE Leucine-rich repeat serine/threonine-protein kinase 1 OS=Mus musculus GN=Lrrk1 PE=1 SV=1 401 644 2.0E-08
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 398 627 2.0E-08
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 398 598 2.0E-08
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 398 629 2.0E-08
sp|E7FE13|LGR4_DANRE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Danio rerio GN=lgr4 PE=2 SV=1 402 643 2.0E-08
sp|P62046|LRCH1_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Mus musculus GN=Lrch1 PE=1 SV=2 308 525 2.0E-08
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 402 658 2.0E-08
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 468 907 2.0E-08
sp|Q5Z9N5|FON1_ORYSJ Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 OS=Oryza sativa subsp. japonica GN=FON1 PE=1 SV=1 395 643 2.0E-08
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 464 879 3.0E-08
sp|Q9LP24|Y1571_ARATH Probable leucine-rich repeat receptor-like protein kinase At1g35710 OS=Arabidopsis thaliana GN=At1g35710 PE=2 SV=1 366 643 3.0E-08
sp|Q9LRT1|Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana GN=At3g28040 PE=2 SV=1 398 644 3.0E-08
sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 398 647 3.0E-08
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 393 641 3.0E-08
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 357 641 3.0E-08
sp|B0M0P8|GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum GN=gefL PE=2 SV=1 439 644 3.0E-08
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 409 668 3.0E-08
sp|Q22875|SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans GN=soc-2 PE=1 SV=3 398 641 4.0E-08
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 357 598 4.0E-08
sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=1 SV=1 395 642 4.0E-08
sp|Q8LFN2|Y3037_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 OS=Arabidopsis thaliana GN=At3g03770 PE=2 SV=1 398 577 4.0E-08
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 340 642 4.0E-08
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 248 643 5.0E-08
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 466 653 5.0E-08
sp|O88520|SHOC2_MOUSE Leucine-rich repeat protein SHOC-2 OS=Mus musculus GN=Shoc2 PE=1 SV=2 438 642 5.0E-08
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 320 618 5.0E-08
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 365 656 5.0E-08
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 398 642 5.0E-08
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 436 644 5.0E-08
sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1 442 621 5.0E-08
sp|B4PU77|SUR8_DROYA Leucine-rich repeat protein soc-2 homolog OS=Drosophila yakuba GN=Sur-8 PE=3 SV=1 397 665 6.0E-08
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 248 643 6.0E-08
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 248 643 6.0E-08
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 398 643 6.0E-08
sp|A7SFP1|SHOC2_NEMVE Leucine-rich repeat protein soc-2 homolog OS=Nematostella vectensis GN=v1g189306 PE=3 SV=1 398 643 6.0E-08
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 401 605 6.0E-08
sp|Q9SYQ8|CLV1_ARATH Receptor protein kinase CLAVATA1 OS=Arabidopsis thaliana GN=CLV1 PE=1 SV=3 398 641 6.0E-08
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 398 662 6.0E-08
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 393 629 6.0E-08
sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 408 804 7.0E-08
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 436 644 7.0E-08
sp|Q9D9Q0|LRC69_MOUSE Leucine-rich repeat-containing protein 69 OS=Mus musculus GN=Lrrc69 PE=2 SV=1 439 647 7.0E-08
sp|Q9VJ07|PHLPP_DROME Protein phosphatase PHLPP-like protein OS=Drosophila melanogaster GN=Phlpp PE=3 SV=1 398 643 7.0E-08
sp|Q6AYI5|SHOC2_RAT Leucine-rich repeat protein SHOC-2 OS=Rattus norvegicus GN=Shoc2 PE=2 SV=1 438 642 8.0E-08
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 398 643 8.0E-08
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 398 626 8.0E-08
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 307 519 8.0E-08
sp|Q8N9N7|LRC57_HUMAN Leucine-rich repeat-containing protein 57 OS=Homo sapiens GN=LRRC57 PE=1 SV=1 540 643 8.0E-08
sp|A6QLV3|SHOC2_BOVIN Leucine-rich repeat protein SHOC-2 OS=Bos taurus GN=SHOC2 PE=2 SV=1 438 642 9.0E-08
sp|Q5VUJ6|LRCH2_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Homo sapiens GN=LRCH2 PE=2 SV=2 394 557 9.0E-08
sp|Q9SGP2|HSL1_ARATH Receptor-like protein kinase HSL1 OS=Arabidopsis thaliana GN=HSL1 PE=2 SV=1 401 656 9.0E-08
sp|C0LGT6|EFR_ARATH LRR receptor-like serine/threonine-protein kinase EFR OS=Arabidopsis thaliana GN=EFR PE=1 SV=1 398 641 9.0E-08
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 495 644 9.0E-08
sp|B0BLW3|LGR4_XENTR Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Xenopus tropicalis GN=lgr4 PE=1 SV=1 402 643 9.0E-08
sp|Q3KQF4|LRC69_XENLA Leucine-rich repeat-containing protein 69 OS=Xenopus laevis GN=lrrc69 PE=2 SV=1 399 647 9.0E-08
sp|Q6GPJ5|LRC40_XENLA Leucine-rich repeat-containing protein 40 OS=Xenopus laevis GN=lrrc40 PE=2 SV=1 761 951 1.0E-07
sp|Q4H4B6|SCRIB_DANRE Protein scribble homolog OS=Danio rerio GN=scrib PE=1 SV=1 468 643 1.0E-07
sp|Q9SCT4|IMK2_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase IMK2 OS=Arabidopsis thaliana GN=IMK2 PE=1 SV=1 421 643 1.0E-07
sp|Q5RAV5|SHOC2_PONAB Leucine-rich repeat protein SHOC-2 OS=Pongo abelii GN=SHOC2 PE=2 SV=2 438 642 1.0E-07
sp|Q9UQ13|SHOC2_HUMAN Leucine-rich repeat protein SHOC-2 OS=Homo sapiens GN=SHOC2 PE=1 SV=2 438 642 1.0E-07
sp|Q3UMG5|LRCH2_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 2 OS=Mus musculus GN=Lrch2 PE=2 SV=2 394 557 1.0E-07
sp|P08678|CYAA_YEAST Adenylate cyclase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYR1 PE=1 SV=2 356 622 1.0E-07
sp|Q54AX5|LRRA_DICDI Leucine-rich repeat protein lrrA OS=Dictyostelium discoideum GN=lrrA PE=1 SV=1 397 643 1.0E-07
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 393 557 1.0E-07
sp|O75094|SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens GN=SLIT3 PE=2 SV=3 321 645 1.0E-07
sp|Q6ZNQ3|LRC69_HUMAN Leucine-rich repeat-containing protein 69 OS=Homo sapiens GN=LRRC69 PE=2 SV=2 439 655 1.0E-07
sp|Q96DD0|LRC39_HUMAN Leucine-rich repeat-containing protein 39 OS=Homo sapiens GN=LRRC39 PE=2 SV=1 465 643 1.0E-07
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 397 625 1.0E-07
sp|Q24K06|LRC10_BOVIN Leucine-rich repeat-containing protein 10 OS=Bos taurus GN=LRRC10 PE=2 SV=1 485 645 1.0E-07
sp|C0LGQ9|Y4294_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g20940 OS=Arabidopsis thaliana GN=At4g20940 PE=1 SV=1 334 620 1.0E-07
sp|Q9Y2L9|LRCH1_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 1 OS=Homo sapiens GN=LRCH1 PE=1 SV=3 308 525 2.0E-07
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 352 577 2.0E-07
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 344 626 2.0E-07
sp|P23466|CYAA_LACKL Adenylate cyclase OS=Lachancea kluyveri GN=CYR1 PE=3 SV=1 396 643 2.0E-07
sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 398 642 2.0E-07
sp|C0LGE4|Y1124_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g12460 OS=Arabidopsis thaliana GN=At1g12460 PE=2 SV=1 398 644 2.0E-07
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 380 656 2.0E-07
sp|A8XWW4|SHOC2_CAEBR Leucine-rich repeat protein soc-2 OS=Caenorhabditis briggsae GN=soc-2 PE=3 SV=1 401 630 2.0E-07
sp|Q8N1G4|LRC47_HUMAN Leucine-rich repeat-containing protein 47 OS=Homo sapiens GN=LRRC47 PE=1 SV=1 482 660 2.0E-07
sp|O65440|BAME3_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3 OS=Arabidopsis thaliana GN=BAM3 PE=2 SV=3 398 631 2.0E-07
sp|Q5FVI3|LRC57_RAT Leucine-rich repeat-containing protein 57 OS=Rattus norvegicus GN=Lrrc57 PE=2 SV=1 540 643 2.0E-07
sp|Q54Y32|MPL3_DICDI MAP kinase phosphatase with leucine-rich repeats protein 3 OS=Dictyostelium discoideum GN=mpl3 PE=3 SV=1 419 607 2.0E-07
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 393 633 2.0E-07
sp|P14605|CYAA_SCHPO Adenylate cyclase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyr1 PE=1 SV=1 398 661 2.0E-07
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 300 641 2.0E-07
sp|Q7XK44|PIRL3_ORYSJ Plant intracellular Ras-group-related LRR protein 3 OS=Oryza sativa subsp. japonica GN=IRL3 PE=2 SV=3 437 665 2.0E-07
sp|P82963|CHAO_TRICA Chaoptin (Fragment) OS=Tribolium castaneum GN=CHP PE=2 SV=1 414 629 2.0E-07
sp|Q8AVS8|LRC59_XENLA Leucine-rich repeat-containing protein 59 OS=Xenopus laevis GN=lrrc59 PE=2 SV=1 543 643 2.0E-07
sp|Q5I2M3|TLR9_PIG Toll-like receptor 9 OS=Sus scrofa GN=TLR9 PE=2 SV=1 436 643 2.0E-07
sp|Q940E8|FEA2_MAIZE Leucine-rich repeat receptor-like protein FASCIATED EAR2 OS=Zea mays GN=FEA2 PE=1 SV=1 398 624 3.0E-07
sp|Q3UVD5|LGR6_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Mus musculus GN=Lgr6 PE=2 SV=1 424 643 3.0E-07
sp|Q8S7M7|PIRL5_ORYSJ Plant intracellular Ras-group-related LRR protein 5 OS=Oryza sativa subsp. japonica GN=IRL5 PE=2 SV=1 478 658 3.0E-07
sp|O61967|LAP1_CAEEL Protein lap1 OS=Caenorhabditis elegans GN=let-413 PE=1 SV=3 390 641 3.0E-07
sp|Q9FRS6|PXL1_ARATH Leucine-rich repeat receptor-like protein kinase PXL1 OS=Arabidopsis thaliana GN=PXL1 PE=1 SV=1 398 644 3.0E-07
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 439 643 3.0E-07
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 398 642 3.0E-07
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 398 643 3.0E-07
sp|Q6QMY6|TSK_RAT Tsukushin OS=Rattus norvegicus GN=Tsku PE=2 SV=1 424 642 3.0E-07
sp|Q9FN37|PSKR2_ARATH Phytosulfokine receptor 2 OS=Arabidopsis thaliana GN=PSKR2 PE=2 SV=1 398 619 3.0E-07
sp|O22938|PXC3_ARATH Leucine-rich repeat receptor-like tyrosine-protein kinase PXC3 OS=Arabidopsis thaliana GN=PXC3 PE=2 SV=1 347 643 3.0E-07
sp|Q8BGI7|LRC39_MOUSE Leucine-rich repeat-containing protein 39 OS=Mus musculus GN=Lrrc39 PE=1 SV=1 465 643 3.0E-07
sp|Q5I2M7|TLR9_FELCA Toll-like receptor 9 OS=Felis catus GN=TLR9 PE=2 SV=1 436 643 3.0E-07
sp|E9Q7T7|CHADL_MOUSE Chondroadherin-like protein OS=Mus musculus GN=Chadl PE=1 SV=1 399 643 3.0E-07
sp|Q6XAT2|ERL2_ARATH LRR receptor-like serine/threonine-protein kinase ERL2 OS=Arabidopsis thaliana GN=ERL2 PE=2 SV=1 398 556 4.0E-07
sp|Q9M2Z1|BAME2_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM2 OS=Arabidopsis thaliana GN=BAM2 PE=1 SV=1 420 656 4.0E-07
sp|Q3V1N1|MFHA1_MOUSE Malignant fibrous histiocytoma-amplified sequence 1 homolog OS=Mus musculus GN=Mfhas1 PE=2 SV=2 398 631 4.0E-07
sp|Q80VQ1|LRRC1_MOUSE Leucine-rich repeat-containing protein 1 OS=Mus musculus GN=Lrrc1 PE=1 SV=2 315 643 4.0E-07
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 398 577 4.0E-07
sp|P49606|CYAA_USTMA Adenylate cyclase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UAC1 PE=3 SV=1 421 638 4.0E-07
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 398 663 4.0E-07
sp|P22792|CPN2_HUMAN Carboxypeptidase N subunit 2 OS=Homo sapiens GN=CPN2 PE=1 SV=3 424 643 4.0E-07
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 393 580 4.0E-07
sp|A8JAM0|DRC7_CHLRE Dynein regulatory complex subunit 7 (Fragment) OS=Chlamydomonas reinhardtii GN=DRC7 PE=1 SV=1 444 633 4.0E-07
sp|Q8BLU0|FLRT2_MOUSE Leucine-rich repeat transmembrane protein FLRT2 OS=Mus musculus GN=Flrt2 PE=1 SV=1 393 733 4.0E-07
sp|D3ZTV3|FLRT2_RAT Leucine-rich repeat transmembrane protein FLRT2 OS=Rattus norvegicus GN=Flrt2 PE=1 SV=1 393 733 4.0E-07
sp|Q9D1G5|LRC57_MOUSE Leucine-rich repeat-containing protein 57 OS=Mus musculus GN=Lrrc57 PE=1 SV=1 540 643 4.0E-07
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 398 577 5.0E-07
sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 419 662 5.0E-07
sp|Q6NX28|LRC59_XENTR Leucine-rich repeat-containing protein 59 OS=Xenopus tropicalis GN=lrrc59 PE=2 SV=1 543 643 5.0E-07
sp|Q7F8Q9|MSL1_ORYSJ Leucine-rich repeat receptor protein kinase MSL1 OS=Oryza sativa subsp. japonica GN=MSL1 PE=2 SV=1 320 595 6.0E-07
sp|C0LGW6|ERL1_ARATH LRR receptor-like serine/threonine-protein kinase ERL1 OS=Arabidopsis thaliana GN=ERL1 PE=1 SV=1 421 643 6.0E-07
sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 398 641 6.0E-07
sp|B0W6M9|SUR8_CULQU Leucine-rich repeat protein soc-2 homolog OS=Culex quinquefasciatus GN=Sur-8 PE=3 SV=1 393 643 6.0E-07
sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 47 OS=Mus musculus GN=Lrrc47 PE=1 SV=1 482 651 6.0E-07
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 421 636 6.0E-07
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 398 641 6.0E-07
sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 398 557 6.0E-07
sp|Q6GLE8|LRC28_XENTR Leucine-rich repeat-containing protein 28 OS=Xenopus tropicalis GN=lrrc28 PE=2 SV=1 463 643 6.0E-07
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 342 645 7.0E-07
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 379 643 7.0E-07
sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 401 626 7.0E-07
sp|Q6DHL5|LRC57_DANRE Leucine-rich repeat-containing protein 57 OS=Danio rerio GN=lrrc57 PE=2 SV=1 471 630 7.0E-07
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 398 643 8.0E-07
sp|Q5I2M5|TLR9_BOVIN Toll-like receptor 9 OS=Bos taurus GN=TLR9 PE=1 SV=1 436 618 8.0E-07
sp|Q96II8|LRCH3_HUMAN Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens GN=LRCH3 PE=1 SV=2 395 550 9.0E-07
sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=2 SV=1 398 626 9.0E-07
sp|Q8WUA8|TSK_HUMAN Tsukushin OS=Homo sapiens GN=TSKU PE=2 SV=3 424 668 9.0E-07
sp|Q8YA32|INLI_LISMO Internalin-I OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=inlI PE=3 SV=1 398 645 9.0E-07
sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 314 709 9.0E-07
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 390 550 1.0E-06
sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 334 644 1.0E-06
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 418 642 1.0E-06
sp|Q1L8Y7|SHOC2_DANRE Leucine-rich repeat protein SHOC-2 OS=Danio rerio GN=shoc2 PE=2 SV=1 464 645 1.0E-06
sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 406 643 1.0E-06
sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 415 628 1.0E-06
sp|Q3UY51|LRC55_MOUSE Leucine-rich repeat-containing protein 55 OS=Mus musculus GN=Lrrc55 PE=2 SV=1 794 946 1.0E-06
sp|P0C895|Y2010_ARATH LRR repeats and ubiquitin-like domain-containing protein At2g30105 OS=Arabidopsis thaliana GN=At2g30105 PE=1 SV=1 492 702 1.0E-06
sp|Q4KLL3|LRC55_RAT Leucine-rich repeat-containing protein 55 OS=Rattus norvegicus GN=Lrrc55 PE=2 SV=2 794 946 1.0E-06
sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=2 SV=1 351 598 1.0E-06
sp|Q9HBX9|RXFP1_HUMAN Relaxin receptor 1 OS=Homo sapiens GN=RXFP1 PE=1 SV=2 398 625 1.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 463 643 1.0E-06
sp|Q9ERV7|PIDD1_MOUSE p53-induced death domain-containing protein 1 OS=Mus musculus GN=Pidd1 PE=1 SV=1 403 579 1.0E-06
sp|Q9CQ07|LRC18_MOUSE Leucine-rich repeat-containing protein 18 OS=Mus musculus GN=Lrrc18 PE=2 SV=1 320 531 1.0E-06
sp|Q54T74|SLRA_DICDI S-cell enriched with leucine-rich repeat-containing protein slrA OS=Dictyostelium discoideum GN=slrA PE=2 SV=1 419 621 1.0E-06
sp|Q6Z8P4|PIRL4_ORYSJ Plant intracellular Ras-group-related LRR protein 4 OS=Oryza sativa subsp. japonica GN=IRL4 PE=2 SV=1 479 659 2.0E-06
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 393 898 2.0E-06
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 398 668 2.0E-06
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 334 628 2.0E-06
sp|A6NIV6|LRIQ4_HUMAN Leucine-rich repeat and IQ domain-containing protein 4 OS=Homo sapiens GN=LRRIQ4 PE=3 SV=2 397 644 2.0E-06
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 419 643 2.0E-06
sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=2 SV=3 398 621 2.0E-06
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 391 614 2.0E-06
sp|C0LGV1|RCH1_ARATH LRR receptor-like serine/threonine-protein kinase RCH1 OS=Arabidopsis thaliana GN=RCH1 PE=2 SV=1 398 626 2.0E-06
sp|Q9LJM4|IKU2_ARATH Receptor-like protein kinase HAIKU2 OS=Arabidopsis thaliana GN=IKU2 PE=1 SV=1 416 620 2.0E-06
sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 329 644 2.0E-06
sp|Q9C9N5|Y1668_ARATH Probable inactive leucine-rich repeat receptor-like protein kinase At1g66830 OS=Arabidopsis thaliana GN=At1g66830 PE=2 SV=1 388 644 2.0E-06
sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 317 620 2.0E-06
sp|Q8K3W2|LRC10_MOUSE Leucine-rich repeat-containing protein 10 OS=Mus musculus GN=Lrrc10 PE=1 SV=1 484 645 2.0E-06
sp|A4IHG1|LRC58_XENTR Leucine-rich repeat-containing protein 58 OS=Xenopus tropicalis GN=lrrc58 PE=2 SV=1 477 646 2.0E-06
sp|Q8W4Q3|PIRL3_ARATH Plant intracellular Ras-group-related LRR protein 3 OS=Arabidopsis thaliana GN=PIRL3 PE=2 SV=1 348 576 3.0E-06
sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 391 643 3.0E-06
sp|Q9LZV7|PXC2_ARATH Leucine-rich repeat receptor-like protein kinase PXC2 OS=Arabidopsis thaliana GN=PXC2 PE=2 SV=1 398 643 3.0E-06
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 398 649 3.0E-06
sp|C0LGX3|HSL2_ARATH LRR receptor-like serine/threonine-protein kinase HSL2 OS=Arabidopsis thaliana GN=HSL2 PE=2 SV=1 419 643 3.0E-06
sp|Q9LY03|IRK_ARATH Probable LRR receptor-like serine/threonine-protein kinase IRK OS=Arabidopsis thaliana GN=IRK PE=1 SV=1 421 664 3.0E-06
sp|Q55CS8|MPL2_DICDI MAP kinase phosphatase with leucine-rich repeats protein 2 OS=Dictyostelium discoideum GN=mpl2 PE=3 SV=2 437 647 3.0E-06
sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 321 614 3.0E-06
sp|O65375|LRX1_ARATH Leucine-rich repeat extensin-like protein 1 OS=Arabidopsis thaliana GN=LRX1 PE=1 SV=1 393 628 3.0E-06
sp|A2ARI4|LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus GN=Lgr4 PE=1 SV=1 401 643 3.0E-06
sp|Q62192|CD180_MOUSE CD180 antigen OS=Mus musculus GN=Cd180 PE=1 SV=2 395 639 3.0E-06
sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 398 577 4.0E-06
sp|Q6XHA6|ROC10_DICDI Probable inactive serine/threonine-protein kinase roco10 OS=Dictyostelium discoideum GN=roco10 PE=3 SV=1 398 645 4.0E-06
sp|Q80ZI6|LRSM1_MOUSE E3 ubiquitin-protein ligase LRSAM1 OS=Mus musculus GN=Lrsam1 PE=1 SV=1 446 553 4.0E-06
sp|Q5I2M7|TLR9_FELCA Toll-like receptor 9 OS=Felis catus GN=TLR9 PE=2 SV=1 391 640 4.0E-06
sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=2 SV=1 390 877 4.0E-06
sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota GN=PSKR PE=1 SV=1 421 637 4.0E-06
sp|Q8IUZ0|LRC49_HUMAN Leucine-rich repeat-containing protein 49 OS=Homo sapiens GN=LRRC49 PE=2 SV=2 398 551 4.0E-06
sp|Q0WR59|Y5020_ARATH Probable inactive receptor kinase At5g10020 OS=Arabidopsis thaliana GN=At5g10020 PE=1 SV=2 390 606 4.0E-06
sp|Q9M9S4|Y1143_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g14390 OS=Arabidopsis thaliana GN=At1g14390 PE=2 SV=1 420 606 4.0E-06
sp|Q9LUI1|LRX6_ARATH Leucine-rich repeat extensin-like protein 6 OS=Arabidopsis thaliana GN=LRX6 PE=2 SV=1 404 633 4.0E-06
sp|Q8BXA7|PHLP2_MOUSE PH domain leucine-rich repeat-containing protein phosphatase 2 OS=Mus musculus GN=Phlpp2 PE=1 SV=3 354 554 5.0E-06
sp|O60346|PHLP1_HUMAN PH domain leucine-rich repeat-containing protein phosphatase 1 OS=Homo sapiens GN=PHLPP1 PE=1 SV=3 357 643 5.0E-06
sp|Q91YK0|LRC49_MOUSE Leucine-rich repeat-containing protein 49 OS=Mus musculus GN=Lrrc49 PE=1 SV=1 398 551 5.0E-06
sp|Q9BXB1|LGR4_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Homo sapiens GN=LGR4 PE=1 SV=2 397 624 5.0E-06
sp|O08742|GPV_MOUSE Platelet glycoprotein V OS=Mus musculus GN=Gp5 PE=1 SV=1 353 642 5.0E-06
sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis GN=cnot6 PE=1 SV=1 565 669 5.0E-06
sp|Q9HB75|PIDD1_HUMAN p53-induced death domain-containing protein 1 OS=Homo sapiens GN=PIDD1 PE=1 SV=2 408 555 6.0E-06
sp|C0LGK9|Y2242_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g24230 OS=Arabidopsis thaliana GN=At2g24230 PE=2 SV=1 382 643 6.0E-06
sp|Q505F5|LRC47_MOUSE Leucine-rich repeat-containing protein 47 OS=Mus musculus GN=Lrrc47 PE=1 SV=1 814 942 6.0E-06
sp|Q00874|DR100_ARATH DNA-damage-repair/toleration protein DRT100 OS=Arabidopsis thaliana GN=DRT100 PE=2 SV=2 439 643 6.0E-06
sp|Q6P3Y9|PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus GN=Podnl1 PE=2 SV=2 472 908 6.0E-06
sp|Q6UWE0|LRSM1_HUMAN E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens GN=LRSAM1 PE=1 SV=1 446 590 6.0E-06
sp|Q80TH2|LAP2_MOUSE Protein LAP2 OS=Mus musculus GN=Erbb2ip PE=1 SV=3 421 644 7.0E-06
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 398 924 7.0E-06
sp|Q9LYN8|EMS1_ARATH Leucine-rich repeat receptor protein kinase EMS1 OS=Arabidopsis thaliana GN=EMS1 PE=1 SV=1 398 555 7.0E-06
sp|Q9NZU0|FLRT3_HUMAN Leucine-rich repeat transmembrane protein FLRT3 OS=Homo sapiens GN=FLRT3 PE=1 SV=1 400 642 7.0E-06
sp|Q9WTR8|PHLP1_RAT PH domain leucine-rich repeat protein phosphatase 1 OS=Rattus norvegicus GN=Phlpp1 PE=1 SV=1 393 629 7.0E-06
sp|O48809|LRX2_ARATH Leucine-rich repeat extensin-like protein 2 OS=Arabidopsis thaliana GN=LRX2 PE=2 SV=1 393 620 7.0E-06
sp|Q723K6|INLA_LISMF Internalin-A OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlA PE=3 SV=1 414 645 7.0E-06
sp|Q32NT4|LRC58_XENLA Leucine-rich repeat-containing protein 58 OS=Xenopus laevis GN=lrrc58 PE=2 SV=1 540 646 7.0E-06
sp|Q8BVU0|LRCH3_MOUSE Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Mus musculus GN=Lrch3 PE=1 SV=3 395 550 8.0E-06
sp|G2K3G6|INLA_LISM4 Internalin-A OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=inlA PE=3 SV=1 414 645 8.0E-06
sp|F1MT22|LGR5_BOVIN Leucine-rich repeat-containing G-protein coupled receptor 5 OS=Bos taurus GN=LGR5 PE=3 SV=2 349 700 8.0E-06
sp|C0LGK4|Y2165_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g16250 OS=Arabidopsis thaliana GN=At2g16250 PE=2 SV=1 395 577 8.0E-06
sp|Q5I2M8|TLR9_CANLF Toll-like receptor 9 OS=Canis lupus familiaris GN=TLR9 PE=2 SV=1 436 692 8.0E-06
sp|Q5E9C0|RSU1_BOVIN Ras suppressor protein 1 OS=Bos taurus GN=RSU1 PE=2 SV=1 515 658 9.0E-06
sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 365 643 9.0E-06
sp|Q5Z9N5|FON1_ORYSJ Leucine-rich repeat receptor-like kinase protein FLORAL ORGAN NUMBER1 OS=Oryza sativa subsp. japonica GN=FON1 PE=1 SV=1 401 643 9.0E-06
sp|Q9DBY4|TRIL_MOUSE TLR4 interactor with leucine rich repeats OS=Mus musculus GN=Tril PE=2 SV=1 356 627 9.0E-06
sp|C0LGJ9|Y2278_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g02780 OS=Arabidopsis thaliana GN=At2g02780 PE=2 SV=1 443 606 1.0E-05
sp|P12024|CHAO_DROME Chaoptin OS=Drosophila melanogaster GN=chp PE=1 SV=2 438 643 1.0E-05
sp|Q8RWZ1|SUB_ARATH Protein STRUBBELIG OS=Arabidopsis thaliana GN=SUB PE=1 SV=1 395 529 1.0E-05
sp|Q723X5|INLI_LISMF Internalin-I OS=Listeria monocytogenes serotype 4b (strain F2365) GN=inlI PE=3 SV=1 398 644 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3186
MDSPRDRLGAVPRLSRLPVARPRLAVDHGTRGDGTRDDGASRELQPRKLRHAASMSSCAAARSRPSLSQRTIDTL
SQLPSSPAMSKKPSSFFEQPPRSESRGSDVSNGCVDIRSTSLATPTPRRRSHFAHKTPRSTAPTIPARRASTASP
SKLPSSVVTSTKKTPPGPPPAKAVPAKTLAARAAASKPNPNGLFKKPSLPALNRTVEKPNPTRLHPQTPVATRNG
AVSPFRPTEQPGGPASLRGARSSAALRDQIAKAKAATRAAAKQQGRSAPSSEVAAPSAIFDPDATYDDPFNLRRG
EDANTKVIKQRLSAARCSGRLNIAALGLKEIPRQVIHMYDLETTGTIDGSWAESVDLRRLVAADNEIKTLDDALF
PDLDPTSLMDEDQDSSGGIFFGLETLDLHGNVLSGVPLGFRRLLHLTSLNLSSNRLDNDCLDVIAQIPGLKDLSL
AKNHLSGPLNPVLCRLGSLEALDVHGNDITALPADMEHLSLLRTLNLSENKLGSLRFDSLAKLPLTQLLVRKNKL
SGALIREPISSLPFLQTLDVSANQLTHLVPPGSSISLPVVNSVSLSMNRLQGLPDMATWVKLVTLAVQDNHISSI
PESFASLGKLRHADFSSNHVRVVPPEIARMGELTTMWLRGNPLVDRKFTTISTDQLREALAVRLEPPPPYQESGD
GHSAMDVDRKQKPASDWDSRSDGEDDFATPPTSAPHSPVRSPSAAGSSPSRSSSAPAPEAWPVKSGGLLERSRMG
LTDLDKTACQEVARRHRVRQAQLHHNQLACIPVAVTTFSTTLVSLSLAHNLFSGSSYLTEELELAALTEINLSSN
AIRDLEPLTRFLRAPSLNKMDVSRNRLERLPEKLRRAFPQLSVLLASNNQLSELEPEWIQGLKMVDVSSNEIAHL
NPRIGLLGGRGGLQRLELSGNRFRTPRWTILERGTEATLQWLRGRMPVEEMALWREENGVGSDDELE*
Coding >Ophun1|3186
ATGGACAGCCCCCGGGACCGTCTCGGAGCCGTTCCGCGACTCTCCCGGCTGCCCGTTGCGAGGCCGAGGCTGGCC
GTTGACCATGGGACTCGTGGCGATGGCACTCGTGACGACGGGGCCTCGCGCGAGCTACAGCCTCGGAAGCTTCGT
CATGCTGCTTCCATGTCTTCGTGTGCCGCCGCCAGGTCGAGACCATCTCTCTCGCAGCGCACCATCGATACCCTC
TCCCAGCTTCCCTCGTCACCGGCCATGAGCAAGAAGCCATCGTCTTTCTTCGAGCAGCCGCCCAGGTCCGAAAGC
CGCGGCTCCGACGTCAGCAACGGCTGTGTCGACATCAGGTCCACCTCGCTTGCCACCCCGACGCCGAGAAGACGC
TCTCACTTTGCTCATAAGACGCCTCGCTCGACTGCGCCGACGATTCCGGCCCGACGAGCTTCGACAGCGTCTCCT
TCCAAACTGCCGAGCTCTGTTGTCACATCGACCAAGAAGACACCGCCGGGTCCGCCCCCGGCCAAAGCGGTGCCG
GCCAAGACGTTGGCTGCCAGGGCAGCGGCCTCTAAGCCGAACCCCAACGGCCTATTCAAGAAGCCATCTCTGCCG
GCACTGAACCGGACTGTCGAAAAGCCAAATCCCACACGACTCCATCCTCAAACGCCCGTCGCCACCCGCAATGGA
GCCGTCTCTCCCTTTCGACCGACCGAACAGCCAGGAGGTCCGGCTTCTCTACGCGGTGCCCGATCCTCGGCCGCG
TTACGGGACCAGATCGCCAAGGCCAAGGCGGCCACCAGAGCCGCGGCGAAGCAGCAGGGTCGGTCTGCGCCATCC
AGCGAGGTCGCTGCTCCAAGCGCCATCTTCGACCCGGACGCGACTTACGATGACCCCTTTAACCTGCGACGAGGA
GAGGACGCCAACACGAAAGTCATCAAGCAGCGCTTATCGGCAGCCAGGTGCTCGGGCCGGCTCAACATAGCAGCC
CTAGGCCTCAAAGAGATACCTCGACAAGTCATTCACATGTACGACCTGGAAACCACTGGAACGATTGACGGCAGC
TGGGCCGAGAGTGTGGACCTCAGGAGGCTCGTAGCAGCTGACAACGAGATAAAGACGCTGGATGACGCCCTTTTC
CCTGATCTCGATCCCACCAGCTTGATGGACGAGGACCAAGACAGCTCGGGCGGCATCTTCTTTGGCCTGGAGACG
CTCGATCTGCACGGAAATGTGCTTTCCGGCGTGCCTCTCGGCTTCCGTCGCCTCCTCCACCTGACGTCTCTCAAC
TTGTCGTCCAATCGACTCGACAATGACTGTCTGGACGTGATTGCTCAGATTCCAGGCTTGAAAGACCTCAGCTTG
GCAAAGAACCATCTCTCGGGCCCGCTGAACCCGGTGCTTTGCCGTCTCGGATCTCTCGAAGCGCTGGACGTTCAC
GGCAACGACATTACAGCTCTGCCGGCCGACATGGAGCACCTTTCGCTCCTACGCACCCTGAATCTCAGTGAGAAC
AAGCTCGGCTCGCTGCGATTCGACAGCCTCGCAAAACTTCCCCTGACCCAGCTTTTGGTGAGGAAGAATAAGCTG
TCCGGCGCCCTCATCCGGGAGCCCATCAGTTCGCTTCCCTTTTTGCAGACGCTCGACGTGTCTGCCAATCAGCTT
ACGCACCTCGTTCCGCCGGGATCGTCCATCAGCCTGCCGGTCGTGAATTCTGTCTCGCTGTCGATGAACCGGCTT
CAGGGGCTCCCCGACATGGCTACGTGGGTGAAGCTCGTCACGCTCGCCGTGCAGGACAATCATATCTCGAGCATC
CCCGAAAGCTTCGCCAGCCTGGGAAAGCTGCGACACGCCGACTTCTCCAGCAACCACGTCCGGGTGGTGCCGCCG
GAGATTGCCAGGATGGGGGAACTGACGACCATGTGGCTCCGGGGCAATCCCCTCGTCGACCGCAAGTTTACCACG
ATTTCGACGGATCAGCTCAGGGAGGCGCTGGCCGTGAGGCTGGAGCCGCCCCCGCCGTATCAGGAGTCCGGAGAC
GGTCACTCGGCCATGGACGTGGACAGGAAGCAGAAACCGGCAAGCGATTGGGATAGCCGATCGGACGGCGAAGAC
GACTTTGCCACGCCGCCCACGTCGGCGCCGCATTCGCCGGTCCGGTCACCGTCGGCGGCTGGCAGCTCTCCGTCG
AGGTCGTCGTCGGCGCCGGCGCCCGAGGCGTGGCCGGTCAAGTCCGGGGGCCTGCTAGAGAGGTCTCGCATGGGG
TTGACGGACCTGGACAAGACGGCGTGTCAGGAGGTTGCGAGGCGGCACCGCGTTCGACAGGCACAACTCCACCAC
AATCAGCTGGCGTGCATCCCCGTGGCGGTGACGACGTTCAGCACAACCTTGGTATCGCTCTCGCTGGCGCACAAC
CTCTTCAGCGGCAGCTCGTACCTGACGGAGGAGCTGGAGCTGGCGGCGCTGACGGAGATCAACCTGTCATCCAAC
GCCATCAGGGACCTCGAACCGCTGACGAGGTTTCTACGCGCGCCGAGCTTGAACAAGATGGACGTGTCGCGGAAC
CGGCTGGAGCGTCTTCCCGAGAAACTGAGACGGGCTTTCCCGCAGCTGTCGGTGCTGCTGGCGTCCAACAATCAG
CTGAGCGAGCTGGAGCCGGAGTGGATCCAGGGGCTGAAGATGGTGGACGTGTCAAGCAACGAGATTGCGCATCTG
AACCCTCGCATCGGGCTGCTGGGCGGACGGGGCGGGCTGCAGAGGCTTGAGCTGTCGGGCAACCGGTTCAGGACC
CCTAGGTGGACGATCCTGGAAAGGGGGACAGAGGCTACGCTGCAGTGGCTCCGTGGGAGGATGCCGGTCGAAGAG
ATGGCCCTGTGGAGGGAGGAGAACGGGGTGGGCAGCGATGACGAGTTGGAGTGA
Transcript >Ophun1|3186
ATGGACAGCCCCCGGGACCGTCTCGGAGCCGTTCCGCGACTCTCCCGGCTGCCCGTTGCGAGGCCGAGGCTGGCC
GTTGACCATGGGACTCGTGGCGATGGCACTCGTGACGACGGGGCCTCGCGCGAGCTACAGCCTCGGAAGCTTCGT
CATGCTGCTTCCATGTCTTCGTGTGCCGCCGCCAGGTCGAGACCATCTCTCTCGCAGCGCACCATCGATACCCTC
TCCCAGCTTCCCTCGTCACCGGCCATGAGCAAGAAGCCATCGTCTTTCTTCGAGCAGCCGCCCAGGTCCGAAAGC
CGCGGCTCCGACGTCAGCAACGGCTGTGTCGACATCAGGTCCACCTCGCTTGCCACCCCGACGCCGAGAAGACGC
TCTCACTTTGCTCATAAGACGCCTCGCTCGACTGCGCCGACGATTCCGGCCCGACGAGCTTCGACAGCGTCTCCT
TCCAAACTGCCGAGCTCTGTTGTCACATCGACCAAGAAGACACCGCCGGGTCCGCCCCCGGCCAAAGCGGTGCCG
GCCAAGACGTTGGCTGCCAGGGCAGCGGCCTCTAAGCCGAACCCCAACGGCCTATTCAAGAAGCCATCTCTGCCG
GCACTGAACCGGACTGTCGAAAAGCCAAATCCCACACGACTCCATCCTCAAACGCCCGTCGCCACCCGCAATGGA
GCCGTCTCTCCCTTTCGACCGACCGAACAGCCAGGAGGTCCGGCTTCTCTACGCGGTGCCCGATCCTCGGCCGCG
TTACGGGACCAGATCGCCAAGGCCAAGGCGGCCACCAGAGCCGCGGCGAAGCAGCAGGGTCGGTCTGCGCCATCC
AGCGAGGTCGCTGCTCCAAGCGCCATCTTCGACCCGGACGCGACTTACGATGACCCCTTTAACCTGCGACGAGGA
GAGGACGCCAACACGAAAGTCATCAAGCAGCGCTTATCGGCAGCCAGGTGCTCGGGCCGGCTCAACATAGCAGCC
CTAGGCCTCAAAGAGATACCTCGACAAGTCATTCACATGTACGACCTGGAAACCACTGGAACGATTGACGGCAGC
TGGGCCGAGAGTGTGGACCTCAGGAGGCTCGTAGCAGCTGACAACGAGATAAAGACGCTGGATGACGCCCTTTTC
CCTGATCTCGATCCCACCAGCTTGATGGACGAGGACCAAGACAGCTCGGGCGGCATCTTCTTTGGCCTGGAGACG
CTCGATCTGCACGGAAATGTGCTTTCCGGCGTGCCTCTCGGCTTCCGTCGCCTCCTCCACCTGACGTCTCTCAAC
TTGTCGTCCAATCGACTCGACAATGACTGTCTGGACGTGATTGCTCAGATTCCAGGCTTGAAAGACCTCAGCTTG
GCAAAGAACCATCTCTCGGGCCCGCTGAACCCGGTGCTTTGCCGTCTCGGATCTCTCGAAGCGCTGGACGTTCAC
GGCAACGACATTACAGCTCTGCCGGCCGACATGGAGCACCTTTCGCTCCTACGCACCCTGAATCTCAGTGAGAAC
AAGCTCGGCTCGCTGCGATTCGACAGCCTCGCAAAACTTCCCCTGACCCAGCTTTTGGTGAGGAAGAATAAGCTG
TCCGGCGCCCTCATCCGGGAGCCCATCAGTTCGCTTCCCTTTTTGCAGACGCTCGACGTGTCTGCCAATCAGCTT
ACGCACCTCGTTCCGCCGGGATCGTCCATCAGCCTGCCGGTCGTGAATTCTGTCTCGCTGTCGATGAACCGGCTT
CAGGGGCTCCCCGACATGGCTACGTGGGTGAAGCTCGTCACGCTCGCCGTGCAGGACAATCATATCTCGAGCATC
CCCGAAAGCTTCGCCAGCCTGGGAAAGCTGCGACACGCCGACTTCTCCAGCAACCACGTCCGGGTGGTGCCGCCG
GAGATTGCCAGGATGGGGGAACTGACGACCATGTGGCTCCGGGGCAATCCCCTCGTCGACCGCAAGTTTACCACG
ATTTCGACGGATCAGCTCAGGGAGGCGCTGGCCGTGAGGCTGGAGCCGCCCCCGCCGTATCAGGAGTCCGGAGAC
GGTCACTCGGCCATGGACGTGGACAGGAAGCAGAAACCGGCAAGCGATTGGGATAGCCGATCGGACGGCGAAGAC
GACTTTGCCACGCCGCCCACGTCGGCGCCGCATTCGCCGGTCCGGTCACCGTCGGCGGCTGGCAGCTCTCCGTCG
AGGTCGTCGTCGGCGCCGGCGCCCGAGGCGTGGCCGGTCAAGTCCGGGGGCCTGCTAGAGAGGTCTCGCATGGGG
TTGACGGACCTGGACAAGACGGCGTGTCAGGAGGTTGCGAGGCGGCACCGCGTTCGACAGGCACAACTCCACCAC
AATCAGCTGGCGTGCATCCCCGTGGCGGTGACGACGTTCAGCACAACCTTGGTATCGCTCTCGCTGGCGCACAAC
CTCTTCAGCGGCAGCTCGTACCTGACGGAGGAGCTGGAGCTGGCGGCGCTGACGGAGATCAACCTGTCATCCAAC
GCCATCAGGGACCTCGAACCGCTGACGAGGTTTCTACGCGCGCCGAGCTTGAACAAGATGGACGTGTCGCGGAAC
CGGCTGGAGCGTCTTCCCGAGAAACTGAGACGGGCTTTCCCGCAGCTGTCGGTGCTGCTGGCGTCCAACAATCAG
CTGAGCGAGCTGGAGCCGGAGTGGATCCAGGGGCTGAAGATGGTGGACGTGTCAAGCAACGAGATTGCGCATCTG
AACCCTCGCATCGGGCTGCTGGGCGGACGGGGCGGGCTGCAGAGGCTTGAGCTGTCGGGCAACCGGTTCAGGACC
CCTAGGTGGACGATCCTGGAAAGGGGGACAGAGGCTACGCTGCAGTGGCTCCGTGGGAGGATGCCGGTCGAAGAG
ATGGCCCTGTGGAGGGAGGAGAACGGGGTGGGCAGCGATGACGAGTTGGAGTGA
Gene >Ophun1|3186
ATGGACAGCCCCCGGGACCGTCTCGGAGCCGTTCCGCGACTCTCCCGGCTGCCCGTTGCGAGGCCGAGGCTGGCC
GTTGACCATGGGACTCGTGGCGATGGCACTCGTGACGACGGGGCCTCGCGCGAGCTACAGCCTCGGAAGCTTCGT
CATGCTGCTTCCATGTCTTCGTGTGCCGCCGCCAGGTCGAGACCATCTCTCTCGCAGCGCACCATCGATACCCTC
TCCCAGCTTCCCTCGTCACCGGCCATGAGCAAGAAGCCATCGTCTTTCTTCGAGCAGCCGCCCAGGTCCGAAAGC
CGCGGCTCCGACGTCAGCAACGGCTGTGTCGACATCAGGTCCACCTCGCTTGCCACCCCGACGCCGAGAAGACGC
TCTCACTTTGCTCATAAGACGCCTCGCTCGACTGCGCCGACGATTCCGGCCCGACGAGCTTCGACAGCGTCTCCT
TCCAAACTGCCGAGCTCTGTTGTCACATCGACCAAGAAGACACCGCCGGGTCCGCCCCCGGCCAAAGCGGTGCCG
GCCAAGACGTTGGCTGCCAGGGCAGCGGCCTCTAAGCCGAACCCCAACGGCCTATTCAAGAAGCCATCTCTGCCG
GCACTGAACCGGACTGTCGAAAAGCCAAATCCCACACGACTCCATCCTCAAACGCCCGTCGCCACCCGCAATGGA
GCCGTCTCTCCCTTTCGACCGACCGAACAGCCAGGAGGTCCGGCTTCTCTACGCGGTGCCCGATCCTCGGCCGCG
TTACGGGACCAGATCGCCAAGGCCAAGGCGGCCACCAGAGCCGCGGCGAAGCAGCAGGGTCGGTCTGCGCCATCC
AGCGAGGTCGCTGCTCCAAGCGCCATCTTCGACCCGGACGCGACTTACGATGACCCCTTTAACCTGCGACGAGGA
GAGGACGCCAACACGAAAGTCATCAAGCAGCGCTTATCGGCAGCCAGGTGCTCGGGCCGGCTCAACATAGCAGCC
CTAGGCCTCAAAGAGATACCTCGACAAGTCATTCACATGTACGACCTGGAAACCACTGGAACGATTGACGGCAGC
TGGGCCGAGAGTGTGGACCTCAGGAGGCTCGTAGCAGCTGACAACGAGATAAAGACGCTGGATGACGCCCTTTTC
CCTGATCTCGATCCCACCAGCTTGATGGACGAGGACCAAGACAGCTCGGGCGGCATCTTCTTTGGCCTGGAGACG
CTCGATCTGCACGGAAATGTGCTTTCCGGCGTGCCTCTCGGCTTCCGTCGCCTCCTCCACCTGACGTCTCTCAAC
TTGGTGAGTGTCGTGGCGGCAGCGGCTGTCAAGGAGCCGAGCTGACAAGGACAGTCGTCCAATCGACTCGACAAT
GACTGTCTGGACGTGATTGCTCAGATTCCAGGCTTGAAAGACCTCAGCTTGGCAAAGAACCATCTCTCGGGCCCG
CTGAACCCGGTGCTTTGCCGTCTCGGATCTCTCGAAGCGCTGGACGTTCACGGCAACGACATTACAGCTCTGCCG
GCCGACATGGAGCACCTTTCGCTCCTACGCACCCTGAATCTCAGTGAGAACAAGCTCGGCTCGCTGCGATTCGAC
AGCCTCGCAAAACTTCCCCTGACCCAGCTTTTGGTGAGGAAGAATAAGCTGTCCGGCGCCCTCATCCGGGAGCCC
ATCAGTTCGCTTCCCTTTTTGCAGACGCTCGACGTGTCTGCCAATCAGCTTACGCACCTCGTTCCGCCGGGATCG
TCCATCAGCCTGCCGGTCGTGAATTCTGTCTCGCTGTCGATGAACCGGCTTCAGGGGCTCCCCGACATGGCTACG
TGGGTGAAGCTCGTCACGCTCGCCGTGCAGGACAATCATATCTCGAGCATCCCCGAAAGCTTCGCCAGCCTGGGA
AAGCTGCGACACGCCGACTTCTCCAGCAACCACGTCCGGGTGGTGCCGCCGGAGATTGCCAGGATGGGGGAACTG
ACGACCATGTGGCTCCGGGGCAATCCCCTCGTCGACCGCAAGTTTACCACGATTTCGACGGATCAGCTCAGGGAG
GCGCTGGCCGTGAGGCTGGAGCCGCCCCCGCCGTATCAGGAGTCCGGAGACGGTCACTCGGCCATGGACGTGGAC
AGGAAGCAGAAACCGGCAAGCGATTGGGATAGCCGATCGGACGGCGAAGACGACTTTGCCACGCCGCCCACGTCG
GCGCCGCATTCGCCGGTCCGGTCACCGTCGGCGGCTGGCAGCTCTCCGTCGAGGTCGTCGTCGGCGCCGGCGCCC
GAGGCGTGGCCGGTCAAGTCCGGGGGCCTGCTAGAGAGGTCTCGCATGGGGTTGACGGACCTGGACAAGACGGCG
TGTCAGGAGGTTGCGAGGCGGCACCGCGTTCGACAGGCACAACTCCACCACAATCAGCTGGCGTGCATCCCCGTG
GCGGTGACGACGTTCAGCACAACCTTGGTATCGCTCTCGCTGGCGCACAACCTCTTCAGCGGCAGCTCGTACCTG
ACGGAGGAGCTGGAGCTGGCGGCGCTGACGGAGATCAACCTGTCATCCAACGCCATCAGGGACCTCGAACCGCTG
ACGAGGTTTCTACGCGCGCCGAGCTTGAACAAGATGGACGTGTCGCGGAACCGGCTGGAGCGTCTTCCCGAGAAA
CTGAGACGGGCTTTCCCGCAGCTGTCGGTGCTGCTGGCGTCCAACAATCAGCTGAGCGAGCTGGAGCCGGAGTGG
ATCCAGGGGCTGAAGATGGTGGACGTGTCAAGCAACGAGATTGCGCATCTGAACCCTCGCATCGGGCTGCTGGGC
GGACGGGGCGGGCTGCAGAGGCTTGAGCTGTCGGGCAACCGGTTCAGGACCCCTAGGTGGACGATCCTGGAAAGG
GGGACAGAGGCTACGCTGCAGTGGCTCCGTGGGAGGATGCCGGTCGAAGAGATGGCCCTGTGGAGGGAGGAGAAC
GGGGTGGGCAGCGATGACGAGTTGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail