Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3183
Gene name
LocationContig_283:4016..8298
Strand+
Gene length (bp)4282
Transcript length (bp)4206
Coding sequence length (bp)4206
Protein length (aa) 1402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 6.1E-37 437 646
PF01061 ABC2_membrane ABC-2 type transporter 2.8E-35 1102 1310
PF00005 ABC_tran ABC transporter 6.5E-13 148 291
PF00005 ABC_tran ABC transporter 1.8E-12 821 957
PF06422 PDR_CDR CDR ABC transporter 6.2E-21 659 739

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 33 1401 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 84 1401 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 76 1401 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 36 1397 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 84 1398 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 33 1401 0.0E+00
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 84 1401 0.0E+00
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 76 1401 0.0E+00
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 36 1397 0.0E+00
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 84 1398 0.0E+00
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 95 1401 0.0E+00
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 39 1398 0.0E+00
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 39 1401 0.0E+00
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 1 1401 0.0E+00
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 94 1400 0.0E+00
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 94 1399 0.0E+00
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 94 1400 0.0E+00
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 50 1401 0.0E+00
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 94 1400 0.0E+00
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 94 1388 0.0E+00
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 129 1389 0.0E+00
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 94 1388 0.0E+00
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 94 1398 0.0E+00
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 94 1400 0.0E+00
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 35 1401 0.0E+00
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 138 1401 6.0E-165
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 108 1401 3.0E-161
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 54 1398 1.0E-157
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 144 1324 3.0E-136
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 142 1045 7.0E-122
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 116 1344 7.0E-119
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 127 1344 2.0E-116
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 92 1344 8.0E-112
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 136 1311 8.0E-112
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 136 1311 1.0E-111
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 110 1324 2.0E-111
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 142 1344 5.0E-111
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 139 1313 8.0E-110
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 48 1344 2.0E-109
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 793 1395 2.0E-109
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 90 1344 1.0E-108
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 136 1344 8.0E-108
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 87 1319 6.0E-107
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 145 1326 1.0E-106
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 123 1313 4.0E-106
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 135 1344 9.0E-106
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 123 1313 1.0E-105
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 104 1319 2.0E-105
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 115 1319 2.0E-105
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 104 1344 3.0E-105
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 116 1313 3.0E-103
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 94 1311 4.0E-103
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 108 1300 4.0E-103
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 26 1316 7.0E-103
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 47 1313 1.0E-102
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 87 1313 2.0E-102
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 135 1311 2.0E-102
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 138 1315 3.0E-102
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 138 1321 3.0E-102
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 119 1313 4.0E-102
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 138 1313 3.0E-101
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 145 1311 2.0E-99
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 133 1320 1.0E-98
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 128 1058 3.0E-98
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 133 1313 1.0E-97
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 88 1313 5.0E-96
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 104 1311 7.0E-95
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 29 1343 2.0E-94
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 130 1311 2.0E-94
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 116 1311 2.0E-89
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 144 708 8.0E-87
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 814 1311 1.0E-68
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 814 1316 2.0E-65
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 814 1311 9.0E-64
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 815 1313 1.0E-63
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 814 1313 1.0E-63
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 787 1324 7.0E-63
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 779 1324 7.0E-62
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 815 1313 6.0E-59
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 805 1323 9.0E-57
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 156 1259 2.0E-53
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 815 1353 6.0E-50
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 807 1333 3.0E-49
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 138 660 8.0E-48
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 138 660 1.0E-46
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 796 1320 2.0E-45
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 811 1299 6.0E-45
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 779 1302 1.0E-44
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 813 1292 2.0E-44
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 794 1296 6.0E-44
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 813 1295 1.0E-43
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 794 1296 3.0E-43
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 813 1299 3.0E-43
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 789 1296 7.0E-43
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 810 1393 1.0E-42
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 799 1396 1.0E-42
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 770 1295 1.0E-42
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 774 1299 1.0E-42
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 136 717 1.0E-42
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 796 1302 3.0E-42
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 813 1299 3.0E-42
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 811 1296 5.0E-42
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 794 1296 1.0E-41
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 769 1298 5.0E-41
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 795 1298 6.0E-41
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 790 1280 6.0E-41
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 136 719 1.0E-40
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 790 1280 2.0E-40
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 795 1320 2.0E-40
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 136 719 6.0E-40
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 794 1298 8.0E-40
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 136 717 1.0E-39
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 813 1395 2.0E-39
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 768 1395 2.0E-39
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 815 1320 2.0E-39
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 795 1320 2.0E-39
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 139 653 3.0E-39
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 795 1335 3.0E-39
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 813 1292 3.0E-39
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 137 717 4.0E-39
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 796 1295 5.0E-39
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 794 1225 8.0E-39
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 768 1395 6.0E-38
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 87 646 9.0E-38
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 139 719 2.0E-37
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 145 651 1.0E-36
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 796 1334 5.0E-36
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 796 1334 5.0E-36
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 796 1299 2.0E-35
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 795 1295 3.0E-35
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 142 630 6.0E-35
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 788 1320 9.0E-35
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 87 645 2.0E-34
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 813 1298 2.0E-34
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 795 1320 2.0E-34
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 826 1295 3.0E-34
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 813 1226 4.0E-34
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 823 1331 6.0E-34
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 823 1238 1.0E-33
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 813 1299 1.0E-33
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 789 1053 3.0E-33
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 823 1315 5.0E-33
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 814 1048 7.0E-33
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 97 630 1.0E-32
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 144 641 2.0E-32
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 138 646 3.0E-32
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 138 656 3.0E-32
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 32 646 6.0E-32
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 811 1225 7.0E-32
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 813 1225 7.0E-32
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 144 654 1.0E-31
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 142 662 1.0E-31
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 807 1234 1.0E-31
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 813 1294 1.0E-31
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 144 654 2.0E-31
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 785 1295 2.0E-31
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 781 1288 4.0E-31
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 142 656 5.0E-31
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 813 1320 5.0E-31
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 813 1320 5.0E-31
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 144 728 1.0E-30
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 135 646 3.0E-30
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 811 1296 3.0E-30
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 139 632 4.0E-30
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 794 1257 4.0E-30
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 142 653 5.0E-30
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 811 1028 6.0E-30
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 145 630 9.0E-30
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 145 677 9.0E-30
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 145 651 1.0E-29
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 813 1288 1.0E-29
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 826 1295 3.0E-29
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 130 650 6.0E-29
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 813 1288 9.0E-29
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 144 651 2.0E-28
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 775 1029 6.0E-28
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 144 719 2.0E-27
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 116 646 3.0E-27
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 144 719 6.0E-27
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 128 647 8.0E-27
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 115 646 8.0E-27
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 140 657 1.0E-26
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 145 653 2.0E-26
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 796 1245 2.0E-26
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 153 656 5.0E-26
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 144 632 7.0E-26
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 144 650 1.0E-25
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 142 735 3.0E-25
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 145 723 3.0E-25
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 814 1325 3.0E-25
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 42 650 3.0E-25
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 813 1046 3.0E-25
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 793 1296 1.0E-24
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 144 647 2.0E-24
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 144 375 2.0E-24
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 144 650 3.0E-24
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 144 650 3.0E-24
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 145 653 6.0E-24
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 141 664 7.0E-24
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 144 574 8.0E-24
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 773 1333 9.0E-24
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 826 1395 9.0E-24
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 814 1389 1.0E-23
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 788 1315 1.0E-23
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 140 661 1.0E-23
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 145 653 1.0E-23
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 154 648 1.0E-23
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 144 648 2.0E-23
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 144 650 2.0E-23
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 810 1399 3.0E-23
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 129 647 3.0E-23
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 144 716 3.0E-23
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 144 719 4.0E-23
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 132 653 6.0E-23
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 142 728 7.0E-23
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 144 719 7.0E-23
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 144 726 7.0E-23
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 145 646 7.0E-23
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 145 646 1.0E-22
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 812 1298 2.0E-22
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 145 657 2.0E-22
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 810 1029 2.0E-22
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 137 663 5.0E-22
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 144 580 1.0E-21
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 154 664 1.0E-21
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 154 647 1.0E-21
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 145 646 2.0E-21
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 137 646 4.0E-21
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 140 646 6.0E-21
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 144 375 7.0E-21
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 144 671 2.0E-20
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 140 647 2.0E-20
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 140 647 2.0E-20
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 108 375 2.0E-20
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 815 1313 3.0E-20
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 137 657 3.0E-20
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 146 728 3.0E-20
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 112 646 1.0E-19
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 144 664 3.0E-19
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 139 646 3.0E-19
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 137 663 4.0E-19
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 145 718 5.0E-19
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 145 647 7.0E-19
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 773 1333 9.0E-19
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 118 650 1.0E-18
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 811 1298 2.0E-18
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 772 1297 5.0E-18
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 807 1302 1.0E-17
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 144 406 1.0E-17
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 145 719 1.0E-17
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 145 647 3.0E-17
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 133 646 7.0E-17
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 810 1298 3.0E-16
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 145 360 3.0E-16
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 796 976 4.0E-16
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 793 1024 4.0E-16
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 114 650 2.0E-15
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 144 356 4.0E-15
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 789 976 4.0E-15
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 149 648 5.0E-15
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 142 632 9.0E-15
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 144 631 3.0E-14
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 793 1024 6.0E-14
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 816 1023 7.0E-14
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 144 735 9.0E-14
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 793 1009 1.0E-13
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 145 390 2.0E-13
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 793 1024 3.0E-13
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 775 1005 3.0E-13
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 144 380 6.0E-13
sp|Q3JHZ1|RBSA2_BURP1 Ribose import ATP-binding protein RbsA 2 OS=Burkholderia pseudomallei (strain 1710b) GN=rbsA2 PE=3 SV=1 781 1018 6.0E-13
sp|Q63P06|RBSA_BURPS Ribose import ATP-binding protein RbsA OS=Burkholderia pseudomallei (strain K96243) GN=rbsA PE=3 SV=1 781 1018 8.0E-13
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 769 1005 9.0E-13
sp|Q9WY65|ECFA2_THEMA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA2 PE=1 SV=1 140 388 2.0E-12
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 137 307 3.0E-12
sp|Q8KFD6|Y391_CHLTE Putative ABC transporter ATP-binding protein CT0391 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0391 PE=3 SV=1 816 1013 3.0E-12
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 793 1005 4.0E-12
sp|Q51719|YCOBA_PROFR Putative ABC transporter ATP-binding protein in cobA 5'region OS=Propionibacterium freudenreichii subsp. shermanii PE=3 SV=1 814 987 5.0E-12
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 137 307 1.0E-11
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 823 1005 1.0E-11
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 795 1032 1.0E-11
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 155 357 1.0E-11
sp|Q38UU0|ECFA2_LACSS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA2 PE=3 SV=1 816 1006 1.0E-11
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 810 986 2.0E-11
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 815 1005 2.0E-11
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 146 354 4.0E-11
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 799 1005 4.0E-11
sp|Q66FK0|HMUV_YERPS Hemin import ATP-binding protein HmuV OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=hmuV PE=3 SV=1 790 1009 5.0E-11
sp|Q1CE65|HMUV_YERPN Hemin import ATP-binding protein HmuV OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=hmuV PE=3 SV=1 790 1009 5.0E-11
sp|Q56993|HMUV_YERPE Hemin import ATP-binding protein HmuV OS=Yersinia pestis GN=hmuV PE=1 SV=1 790 1009 5.0E-11
sp|Q1C0Q8|HMUV_YERPA Hemin import ATP-binding protein HmuV OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=hmuV PE=3 SV=1 790 1009 5.0E-11
sp|P9WQL3|MODC_MYCTU Molybdenum import ATP-binding protein ModC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=modC PE=1 SV=1 823 1030 6.0E-11
sp|P9WQL2|MODC_MYCTO Molybdenum import ATP-binding protein ModC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=modC PE=3 SV=1 823 1030 6.0E-11
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 131 362 6.0E-11
sp|Q2T8T6|RBSA2_BURTA Ribose import ATP-binding protein RbsA 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rbsA2 PE=3 SV=1 795 1018 7.0E-11
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 813 1020 7.0E-11
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 135 377 1.0E-10
sp|Q7N3S7|HMUV_PHOLL Hemin import ATP-binding protein HmuV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmuV PE=3 SV=1 796 1009 1.0E-10
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 131 342 1.0E-10
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 131 342 1.0E-10
sp|Q5MZ54|CMPC_SYNP6 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpC PE=3 SV=1 796 1005 1.0E-10
sp|Q55107|CMPC_SYNE7 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus elongatus (strain PCC 7942) GN=cmpC PE=1 SV=1 796 1005 1.0E-10
sp|Q8YQ88|Y3946_NOSS1 Putative ABC transporter ATP-binding protein alr3946 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3946 PE=3 SV=1 793 1013 2.0E-10
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 816 1005 2.0E-10
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 145 380 3.0E-10
sp|A3CRB8|ECFA2_STRSV Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus sanguinis (strain SK36) GN=ecfA2 PE=3 SV=1 816 1013 3.0E-10
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 811 1012 3.0E-10
sp|Q55462|CMPC_SYNY3 Bicarbonate transport ATP-binding protein CmpC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpC PE=2 SV=1 816 1005 3.0E-10
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 130 425 3.0E-10
sp|A2RI02|ECFA2_LACLM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ecfA2 PE=1 SV=1 814 1005 3.0E-10
sp|Q3SGJ8|PHNC_THIDA Phosphonates import ATP-binding protein PhnC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=phnC PE=3 SV=1 816 1039 3.0E-10
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 804 986 4.0E-10
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 823 1012 4.0E-10
sp|Q664G2|RBSA_YERPS Ribose import ATP-binding protein RbsA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rbsA PE=3 SV=1 816 1005 4.0E-10
sp|Q1CDJ0|RBSA_YERPN Ribose import ATP-binding protein RbsA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rbsA PE=3 SV=1 816 1005 4.0E-10
sp|Q7CG00|RBSA_YERPE Ribose import ATP-binding protein RbsA OS=Yersinia pestis GN=rbsA PE=3 SV=1 816 1005 4.0E-10
sp|Q1C1B8|RBSA_YERPA Ribose import ATP-binding protein RbsA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rbsA PE=3 SV=1 816 1005 4.0E-10
sp|Q9CL63|RBSA2_PASMU Ribose import ATP-binding protein RbsA 2 OS=Pasteurella multocida (strain Pm70) GN=rbsA2 PE=3 SV=1 816 1021 4.0E-10
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 816 1005 5.0E-10
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 789 1005 6.0E-10
sp|Q1CMQ3|THIQ_YERPN Thiamine import ATP-binding protein ThiQ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=thiQ PE=3 SV=1 154 358 6.0E-10
sp|Q0WJE4|THIQ_YERPE Thiamine import ATP-binding protein ThiQ OS=Yersinia pestis GN=thiQ PE=3 SV=2 154 358 6.0E-10
sp|Q1C1Y5|THIQ_YERPA Thiamine import ATP-binding protein ThiQ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=thiQ PE=3 SV=1 154 358 6.0E-10
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 816 1006 6.0E-10
sp|O34814|FTSE_BACSU Cell division ATP-binding protein FtsE OS=Bacillus subtilis (strain 168) GN=ftsE PE=1 SV=1 140 341 6.0E-10
sp|Q55462|CMPC_SYNY3 Bicarbonate transport ATP-binding protein CmpC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpC PE=2 SV=1 146 341 7.0E-10
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 816 1005 8.0E-10
sp|O54187|Y5958_STRCO Putative ABC transporter ATP-binding protein SCO5958 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5958 PE=3 SV=1 815 1021 8.0E-10
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 156 358 9.0E-10
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 816 1005 1.0E-09
sp|A1K323|MACB_AZOSB Macrolide export ATP-binding/permease protein MacB OS=Azoarcus sp. (strain BH72) GN=macB PE=3 SV=1 814 1016 1.0E-09
sp|A0K718|RBSA1_BURCH Ribose import ATP-binding protein RbsA 1 OS=Burkholderia cenocepacia (strain HI2424) GN=rbsA1 PE=3 SV=1 791 1012 1.0E-09
sp|Q1BWN5|RBSA1_BURCA Ribose import ATP-binding protein RbsA 1 OS=Burkholderia cenocepacia (strain AU 1054) GN=rbsA1 PE=3 SV=1 791 1012 1.0E-09
sp|Q032H3|ECFA2_LACLS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ecfA2 PE=3 SV=1 814 1005 1.0E-09
sp|Q21TR5|RGMG_RHOFT Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=Rfer_3129 PE=3 SV=1 823 1060 1.0E-09
sp|Q63R24|PHNC_BURPS Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain K96243) GN=phnC PE=3 SV=2 140 350 1.0E-09
sp|Q3JNY2|PHNC_BURP1 Phosphonates import ATP-binding protein PhnC OS=Burkholderia pseudomallei (strain 1710b) GN=phnC PE=3 SV=1 140 350 1.0E-09
sp|Q62H59|PHNC_BURMA Phosphonates import ATP-binding protein PhnC OS=Burkholderia mallei (strain ATCC 23344) GN=phnC PE=3 SV=1 140 350 1.0E-09
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 135 341 1.0E-09
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 131 350 1.0E-09
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 813 1020 1.0E-09
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 146 347 2.0E-09
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 815 1005 2.0E-09
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 131 349 2.0E-09
sp|Q83F44|METN_COXBU Methionine import ATP-binding protein MetN OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=metN PE=3 SV=1 146 344 2.0E-09
sp|Q39GY8|RBSA1_BURL3 Ribose import ATP-binding protein RbsA 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rbsA1 PE=3 SV=1 791 1005 2.0E-09
sp|Q1JUP7|ARAG_AZOBR Arabinose import ATP-binding protein AraG OS=Azospirillum brasilense GN=araG PE=3 SV=1 783 1011 2.0E-09
sp|Q3BNZ3|METN_XANC5 Methionine import ATP-binding protein MetN OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=metN PE=3 SV=1 155 399 2.0E-09
sp|Q8NR42|SSUB_CORGL Aliphatic sulfonates import ATP-binding protein SsuB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ssuB PE=1 SV=1 812 1006 2.0E-09
sp|Q39BJ8|ARAG2_BURL3 Arabinose import ATP-binding protein AraG 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=araG2 PE=3 SV=1 795 1011 2.0E-09
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 813 1009 2.0E-09
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 816 1009 2.0E-09
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 816 1005 2.0E-09
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 816 1005 2.0E-09
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 826 1012 2.0E-09
sp|A0B3Z7|ARAG2_BURCH Arabinose import ATP-binding protein AraG 2 OS=Burkholderia cenocepacia (strain HI2424) GN=araG2 PE=3 SV=1 783 1011 2.0E-09
sp|Q1BJW2|ARAG2_BURCA Arabinose import ATP-binding protein AraG 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=araG2 PE=3 SV=1 783 1011 2.0E-09
sp|Q2NSR0|HMUV_SODGM Hemin import ATP-binding protein HmuV OS=Sodalis glossinidius (strain morsitans) GN=hmuV PE=3 SV=1 810 1005 2.0E-09
sp|Q8PGE8|METN_XANAC Methionine import ATP-binding protein MetN OS=Xanthomonas axonopodis pv. citri (strain 306) GN=metN PE=3 SV=1 155 399 3.0E-09
sp|Q9KL34|HMUV_VIBCH Hemin import ATP-binding protein HmuV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=hmuV PE=3 SV=2 804 1032 3.0E-09
sp|P36947|RBSA_BACSU Ribose import ATP-binding protein RbsA OS=Bacillus subtilis (strain 168) GN=rbsA PE=3 SV=2 804 1048 3.0E-09
sp|Q88XV1|ECFA2_LACPL Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=ecfA2 PE=3 SV=1 801 1005 3.0E-09
sp|Q9CIS8|ECFA2_LACLA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ecfA2 PE=3 SV=1 814 1005 3.0E-09
sp|Q66EN1|THIQ_YERPS Thiamine import ATP-binding protein ThiQ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=thiQ PE=3 SV=2 154 358 3.0E-09
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 816 1005 4.0E-09
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 779 1006 4.0E-09
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 823 1005 4.0E-09
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 823 1005 4.0E-09
sp|Q6N798|METN2_RHOPA Methionine import ATP-binding protein MetN 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metN2 PE=3 SV=1 141 418 4.0E-09
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 139 375 5.0E-09
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 823 1005 5.0E-09
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 146 341 5.0E-09
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 131 350 5.0E-09
sp|Q98L75|HMUV_RHILO Hemin import ATP-binding protein HmuV OS=Rhizobium loti (strain MAFF303099) GN=hmuV PE=3 SV=1 813 1005 6.0E-09
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1097 1324 7.0E-09
sp|Q0B5V4|ARAG2_BURCM Arabinose import ATP-binding protein AraG 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=araG2 PE=3 SV=1 794 1011 7.0E-09
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 823 1005 7.0E-09
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 815 1014 7.0E-09
sp|Q5L5Z1|METN_CHLAB Methionine import ATP-binding protein MetN OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=metN PE=3 SV=1 128 351 7.0E-09
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 131 362 7.0E-09
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 146 349 7.0E-09
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 135 342 8.0E-09
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 816 989 8.0E-09
sp|Q1GID1|UGPC_RUEST sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria sp. (strain TM1040) GN=ugpC PE=3 SV=1 804 1012 9.0E-09
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 131 349 9.0E-09
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 816 1041 1.0E-08
sp|Q138A9|HMUV_RHOPS Hemin import ATP-binding protein HmuV OS=Rhodopseudomonas palustris (strain BisB5) GN=hmuV PE=3 SV=1 815 1022 1.0E-08
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 813 1009 1.0E-08
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 816 1005 1.0E-08
sp|P0CZ27|ECFA2_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA2 PE=3 SV=1 799 1005 1.0E-08
sp|P0CZ26|ECFA2_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA2 PE=3 SV=1 799 1005 1.0E-08
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 816 1022 1.0E-08
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 135 342 1.0E-08
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 135 342 1.0E-08
sp|Q7MFA1|HMUV_VIBVY Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain YJ016) GN=hmuV PE=3 SV=1 812 1032 1.0E-08
sp|Q46ZM0|UGPC_CUPPJ sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ugpC PE=3 SV=1 804 1025 1.0E-08
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 793 1005 1.0E-08
sp|Q5E0B3|LOLD_VIBF1 Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=lolD PE=3 SV=1 815 1005 1.0E-08
sp|Q02ME3|METN1_PSEAB Methionine import ATP-binding protein MetN 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=metN1 PE=3 SV=1 115 347 1.0E-08
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 793 1023 1.0E-08
sp|Q8TI15|Y4342_METAC Putative ABC transporter ATP-binding protein MA_4342 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_4342 PE=3 SV=1 823 1012 1.0E-08
sp|P57066|LOLD_VIBCH Lipoprotein-releasing system ATP-binding protein LolD OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lolD PE=3 SV=1 814 1005 1.0E-08
sp|P38045|NRTC_SYNE7 Nitrate transport ATP-binding protein NrtC OS=Synechococcus elongatus (strain PCC 7942) GN=nrtC PE=3 SV=1 823 1005 2.0E-08
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 813 1009 2.0E-08
sp|Q48QM3|ECFA2_STRPM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|A2RH10|ECFA2_STRPG Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|Q1J450|ECFA2_STRPF Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|Q1JEC9|ECFA2_STRPD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|Q1JJD0|ECFA2_STRPC Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|Q1J983|ECFA2_STRPB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|Q7CMM8|ECFA2_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|Q5X9B6|ECFA2_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|Q99XI2|ECFA2_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M1 GN=ecfA2 PE=3 SV=1 799 1005 2.0E-08
sp|O70014|HMUV_SHIDY Hemin import ATP-binding protein HmuV OS=Shigella dysenteriae GN=hmuV PE=1 SV=1 795 1009 2.0E-08
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 813 1009 2.0E-08
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 813 1009 2.0E-08
sp|Q5F8K2|LOLD_NEIG1 Lipoprotein-releasing system ATP-binding protein LolD OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lolD PE=3 SV=1 815 1005 2.0E-08
sp|Q32AY3|HMUV_SHIDS Hemin import ATP-binding protein HmuV OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=hmuV PE=3 SV=1 795 1009 2.0E-08
sp|Q748K0|Y3001_GEOSL Putative ABC transporter ATP-binding protein GSU3001 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU3001 PE=3 SV=1 816 1005 2.0E-08
sp|Q035B3|ECFA2_LACC3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus casei (strain ATCC 334) GN=ecfA2 PE=1 SV=1 819 1005 2.0E-08
sp|Q1R597|HMUV_ECOUT Hemin import ATP-binding protein HmuV OS=Escherichia coli (strain UTI89 / UPEC) GN=hmuV PE=3 SV=2 795 1009 2.0E-08
sp|Q8DRS0|ECFA2_STRMU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ecfA2 PE=3 SV=1 814 1005 2.0E-08
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 819 1021 2.0E-08
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 156 366 2.0E-08
sp|Q8FCJ1|HMUV_ECOL6 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hmuV PE=3 SV=2 795 1009 2.0E-08
sp|Q0TBU8|HMUV_ECOL5 Hemin import ATP-binding protein HmuV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hmuV PE=3 SV=1 795 1009 2.0E-08
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 1117 1325 3.0E-08
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 823 1015 3.0E-08
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 823 1049 3.0E-08
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 823 1054 3.0E-08
sp|Q57TF5|THIQ_SALCH Thiamine import ATP-binding protein ThiQ OS=Salmonella choleraesuis (strain SC-B67) GN=thiQ PE=3 SV=1 156 351 3.0E-08
sp|Q8X5Q4|RBSA2_ECO57 Ribose import ATP-binding protein RbsA 2 OS=Escherichia coli O157:H7 GN=rbsA2 PE=3 SV=3 816 1005 3.0E-08
sp|Q8EEV5|LOLD_SHEON Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella oneidensis (strain MR-1) GN=lolD PE=3 SV=1 812 1005 3.0E-08
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 823 1054 3.0E-08
sp|Q5PDF8|THIQ_SALPA Thiamine import ATP-binding protein ThiQ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thiQ PE=3 SV=1 156 351 3.0E-08
sp|Q9I6T2|POTA1_PSEAE Spermidine/putrescine import ATP-binding protein PotA 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA1 PE=3 SV=1 816 1005 3.0E-08
sp|Q8X5N2|HMUV_ECO57 Hemin import ATP-binding protein HmuV OS=Escherichia coli O157:H7 GN=hmuV PE=3 SV=3 795 1009 3.0E-08
sp|Q65E55|RBSA_BACLD Ribose import ATP-binding protein RbsA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbsA PE=3 SV=1 814 1044 3.0E-08
sp|Q9RKC6|Y3161_STRCO Putative ABC transporter ATP-binding protein SCO3161 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3161 PE=3 SV=1 816 981 3.0E-08
sp|Q9WXX0|RBSA1_THEMA Ribose import ATP-binding protein RbsA 1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rbsA1 PE=3 SV=1 795 1034 4.0E-08
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 143 355 4.0E-08
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 144 341 4.0E-08
sp|Q6D645|HMUV_PECAS Hemin import ATP-binding protein HmuV OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=hmuV PE=3 SV=1 826 1009 4.0E-08
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 815 1005 4.0E-08
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 823 1054 4.0E-08
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 811 986 5.0E-08
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 823 1054 5.0E-08
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 826 1005 5.0E-08
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 823 1005 5.0E-08
sp|Q2T4S8|ARAG2_BURTA Arabinose import ATP-binding protein AraG 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=araG2 PE=3 SV=1 784 1011 5.0E-08
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 815 1025 5.0E-08
sp|Q254K9|METN_CHLFF Methionine import ATP-binding protein MetN OS=Chlamydophila felis (strain Fe/C-56) GN=metN PE=3 SV=1 129 349 6.0E-08
sp|Q8D3S8|HMUV_VIBVU Hemin import ATP-binding protein HmuV OS=Vibrio vulnificus (strain CMCP6) GN=hmuV PE=3 SV=1 812 1032 6.0E-08
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 156 358 6.0E-08
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 804 1012 6.0E-08
sp|Q0BFU0|RBSA1_BURCM Ribose import ATP-binding protein RbsA 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rbsA1 PE=3 SV=1 814 1011 6.0E-08
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 128 351 6.0E-08
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 144 341 6.0E-08
sp|Q2K0S7|RBSA3_RHIEC Ribose import ATP-binding protein RbsA 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rbsA3 PE=3 SV=1 789 1020 6.0E-08
sp|Q9KN37|RBSA_VIBCH Ribose import ATP-binding protein RbsA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rbsA PE=3 SV=1 146 383 6.0E-08
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 103 348 7.0E-08
sp|Q55463|CMPD_SYNY3 Bicarbonate transport ATP-binding protein CmpD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpD PE=2 SV=1 775 1005 7.0E-08
sp|Q92MP8|RGMG1_RHIME Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 OS=Rhizobium meliloti (strain 1021) GN=R02565 PE=3 SV=1 816 1021 7.0E-08
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 813 1017 7.0E-08
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 813 1010 7.0E-08
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 115 354 7.0E-08
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 814 1015 8.0E-08
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 823 1005 8.0E-08
sp|Q48KI4|LOLD_PSE14 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=lolD PE=3 SV=1 140 344 8.0E-08
sp|Q8ES39|Y804_OCEIH Putative ABC transporter ATP-binding protein OB0804 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB0804 PE=3 SV=1 815 1006 8.0E-08
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 815 989 8.0E-08
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 813 1005 8.0E-08
sp|Q884I3|LOLD_PSESM Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=lolD PE=3 SV=1 140 344 8.0E-08
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 793 1012 8.0E-08
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 804 1012 8.0E-08
sp|Q6HBS0|METN2_BACHK Methionine import ATP-binding protein MetN 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN2 PE=3 SV=1 823 1054 8.0E-08
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 131 342 9.0E-08
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 823 1054 9.0E-08
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 154 352 9.0E-08
sp|Q92N13|HMUV_RHIME Hemin import ATP-binding protein HmuV OS=Rhizobium meliloti (strain 1021) GN=hmuV PE=3 SV=1 813 1008 1.0E-07
sp|Q8TSC8|Y870_METAC Putative ABC transporter ATP-binding protein MA_0870 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0870 PE=3 SV=1 794 1036 1.0E-07
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 823 1005 1.0E-07
sp|Q3MB44|RBSA_ANAVT Ribose import ATP-binding protein RbsA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rbsA PE=3 SV=1 780 1005 1.0E-07
sp|Q03I83|ECFA2_STRTD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ecfA2 PE=3 SV=1 796 989 1.0E-07
sp|Q5M244|ECFA2_STRT2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ecfA2 PE=1 SV=1 796 989 1.0E-07
sp|Q5LXJ4|ECFA2_STRT1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ecfA2 PE=3 SV=1 796 989 1.0E-07
sp|Q93D97|Y1934_STRMU Putative ABC transporter ATP-binding protein SMU_1934c OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=sdcBA PE=3 SV=1 146 347 1.0E-07
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 815 1012 1.0E-07
sp|Q8TQW9|Y1418_METAC Putative ABC transporter ATP-binding protein MA_1418 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1418 PE=3 SV=1 816 987 1.0E-07
sp|Q3K3R2|RBSA_STRA1 Ribose import ATP-binding protein RbsA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rbsA PE=3 SV=1 812 1005 1.0E-07
sp|Q9RKQ4|HMUV_STRCO Hemin import ATP-binding protein HmuV OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hmuV PE=3 SV=1 813 986 1.0E-07
sp|O29527|Y731_ARCFU Putative ABC transporter ATP-binding protein AF_0731 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_0731 PE=3 SV=2 809 1013 1.0E-07
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 792 1002 1.0E-07
sp|Q93SH7|HMUV_BRADU Hemin import ATP-binding protein HmuV OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hmuV PE=3 SV=1 136 351 1.0E-07
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 146 366 1.0E-07
sp|Q0SBZ1|FBPC1_RHOJR Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhodococcus jostii (strain RHA1) GN=fbpC1 PE=3 SV=1 815 1012 1.0E-07
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 127 351 1.0E-07
sp|Q2SJY7|POTA_HAHCH Spermidine/putrescine import ATP-binding protein PotA OS=Hahella chejuensis (strain KCTC 2396) GN=potA PE=3 SV=1 129 380 1.0E-07
sp|Q8PYH5|Y887_METMA Putative ABC transporter ATP-binding protein MM_0887 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0887 PE=3 SV=1 779 1005 1.0E-07
sp|Q8XHV3|ECFA2_CLOPE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain 13 / Type A) GN=ecfA2 PE=3 SV=1 813 1005 1.0E-07
sp|Q0TMS8|ECFA2_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA2 PE=3 SV=1 813 1005 1.0E-07
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 813 1008 1.0E-07
sp|Q398W2|RBSA2_BURL3 Ribose import ATP-binding protein RbsA 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rbsA2 PE=3 SV=1 793 1009 1.0E-07
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 156 341 1.0E-07
sp|Q080S4|LOLD_SHEFN Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella frigidimarina (strain NCIMB 400) GN=lolD PE=3 SV=1 812 1005 1.0E-07
sp|Q8ZRV2|THIQ_SALTY Thiamine import ATP-binding protein ThiQ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thiQ PE=1 SV=1 156 351 1.0E-07
sp|Q6HI76|Y2424_BACHK Putative ABC transporter ATP-binding protein BT9727_2424 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_2424 PE=3 SV=1 146 344 2.0E-07
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 814 1025 2.0E-07
sp|Q8Z9I6|THIQ_SALTI Thiamine import ATP-binding protein ThiQ OS=Salmonella typhi GN=thiQ PE=3 SV=1 156 351 2.0E-07
sp|Q2K204|RBSA2_RHIEC Ribose import ATP-binding protein RbsA 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rbsA2 PE=3 SV=1 793 1056 2.0E-07
sp|Q329G7|RBSA_SHIDS Ribose import ATP-binding protein RbsA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rbsA PE=3 SV=1 816 1005 2.0E-07
sp|Q9YG51|PSTB_AERPE Phosphate import ATP-binding protein PstB OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pstB PE=3 SV=1 813 1014 2.0E-07
sp|Q2SB47|HMUV_HAHCH Hemin import ATP-binding protein HmuV OS=Hahella chejuensis (strain KCTC 2396) GN=hmuV PE=3 SV=1 813 1009 2.0E-07
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 777 1006 2.0E-07
sp|Q326G9|THIQ_SHIBS Thiamine import ATP-binding protein ThiQ OS=Shigella boydii serotype 4 (strain Sb227) GN=thiQ PE=3 SV=1 156 351 2.0E-07
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 811 1010 2.0E-07
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 811 1010 2.0E-07
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 811 1010 2.0E-07
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 811 1010 2.0E-07
sp|Q0K998|UGPC_CUPNH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ugpC PE=3 SV=1 804 1012 2.0E-07
sp|Q83MG3|THIQ_SHIFL Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri GN=thiQ PE=3 SV=4 156 351 2.0E-07
sp|Q92CK1|Y1170_LISIN Putative ABC transporter ATP-binding protein lin1170 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin1170 PE=3 SV=1 813 1014 2.0E-07
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 813 1008 2.0E-07
sp|Q8UBB7|UGPC2_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC2 PE=3 SV=2 156 358 2.0E-07
sp|Q73KT5|Y2132_TREDE Putative ABC transporter ATP-binding protein TDE_2132 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=TDE_2132 PE=3 SV=1 799 1009 2.0E-07
sp|Q8Y7R4|Y1207_LISMO Putative ABC transporter ATP-binding protein lmo1207 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1207 PE=3 SV=1 813 1014 2.0E-07
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 816 960 2.0E-07
sp|Q8E7N9|RBSA_STRA3 Ribose import ATP-binding protein RbsA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rbsA PE=3 SV=1 812 1005 2.0E-07
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 823 1009 2.0E-07
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 823 1009 2.0E-07
sp|Q0T8D1|THIQ_SHIF8 Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri serotype 5b (strain 8401) GN=thiQ PE=3 SV=1 156 351 2.0E-07
sp|Q9S472|ARAG_GEOSE L-arabinose transport ATP-binding protein AraG OS=Geobacillus stearothermophilus GN=araG PE=3 SV=1 793 1093 2.0E-07
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 131 341 2.0E-07
sp|Q88KY4|LOLD_PSEPK Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas putida (strain KT2440) GN=lolD PE=3 SV=2 140 344 2.0E-07
sp|O34900|TCYN_BACSU L-cystine import ATP-binding protein TcyN OS=Bacillus subtilis (strain 168) GN=tcyN PE=1 SV=1 815 1040 2.0E-07
sp|Q4ZV73|LOLD_PSEU2 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lolD PE=3 SV=2 140 344 2.0E-07
sp|Q8ENB3|RBSA_OCEIH Ribose import ATP-binding protein RbsA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rbsA PE=3 SV=1 812 1005 2.0E-07
sp|Q03CA4|RBSA_LACC3 Ribose import ATP-binding protein RbsA OS=Lactobacillus casei (strain ATCC 334) GN=rbsA PE=3 SV=1 813 1005 2.0E-07
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 823 974 2.0E-07
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 131 341 2.0E-07
sp|Q8E281|RBSA_STRA5 Ribose import ATP-binding protein RbsA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rbsA PE=3 SV=1 812 1005 2.0E-07
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 813 1012 2.0E-07
sp|Q1ARR5|RBSA3_RUBXD Ribose import ATP-binding protein RbsA 3 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rbsA3 PE=3 SV=1 793 1056 2.0E-07
sp|A0KE53|XYLG_BURCH Xylose import ATP-binding protein XylG OS=Burkholderia cenocepacia (strain HI2424) GN=xylG PE=3 SV=1 129 350 2.0E-07
sp|Q1BG93|XYLG_BURCA Xylose import ATP-binding protein XylG OS=Burkholderia cenocepacia (strain AU 1054) GN=xylG PE=3 SV=1 129 350 2.0E-07
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 453 660 3.0E-07
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 816 1012 3.0E-07
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 805 1012 3.0E-07
sp|Q55463|CMPD_SYNY3 Bicarbonate transport ATP-binding protein CmpD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpD PE=2 SV=1 145 347 3.0E-07
sp|P73450|NRTC_SYNY3 Nitrate transport ATP-binding protein NrtC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrtC PE=3 SV=1 816 1013 3.0E-07
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 141 358 3.0E-07
sp|Q2K353|RGMG2_RHIEC Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=RHE_CH03989 PE=3 SV=1 793 1014 3.0E-07
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 814 989 3.0E-07
sp|Q05596|CBIO_SALTY Cobalt import ATP-binding protein CbiO OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cbiO PE=1 SV=2 811 1015 3.0E-07
sp|Q32K28|THIQ_SHIDS Thiamine import ATP-binding protein ThiQ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thiQ PE=3 SV=1 156 351 3.0E-07
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 131 341 3.0E-07
sp|Q8D7T7|RBSA_VIBVU Ribose import ATP-binding protein RbsA OS=Vibrio vulnificus (strain CMCP6) GN=rbsA PE=3 SV=1 146 342 3.0E-07
sp|Q8DMY0|ECFA2_STRR6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ecfA2 PE=3 SV=1 816 1005 3.0E-07
sp|Q04HV8|ECFA2_STRP2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ecfA2 PE=3 SV=1 816 1005 3.0E-07
sp|Q5PDU4|CBIO_SALPA Cobalt import ATP-binding protein CbiO OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cbiO PE=3 SV=1 815 1015 3.0E-07
sp|Q720M2|Y1216_LISMF Putative ABC transporter ATP-binding protein LMOf2365_1216 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_1216 PE=3 SV=1 813 1014 3.0E-07
sp|Q84EY8|HMUV_ENTCL Hemin import ATP-binding protein HmuV OS=Enterobacter cloacae GN=hmuV PE=3 SV=1 807 1005 3.0E-07
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 824 1018 3.0E-07
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 823 1054 3.0E-07
sp|Q7MEV1|RBSA_VIBVY Ribose import ATP-binding protein RbsA OS=Vibrio vulnificus (strain YJ016) GN=rbsA PE=3 SV=1 146 342 3.0E-07
sp|P96605|YDBJ_BACSU Uncharacterized ABC transporter ATP-binding protein YdbJ OS=Bacillus subtilis (strain 168) GN=ydbJ PE=3 SV=1 812 1017 3.0E-07
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 813 1008 3.0E-07
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 813 1008 3.0E-07
sp|Q3J3V9|RBSA_RHOS4 Ribose import ATP-binding protein RbsA OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rbsA PE=3 SV=1 814 1034 3.0E-07
sp|Q87G35|Y5482_VIBPA Putative ABC transporter ATP-binding protein VPA1482 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VPA1482 PE=3 SV=1 788 986 3.0E-07
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 813 1008 3.0E-07
sp|Q9CAF5|AB6I_ARATH ABC transporter I family member 6, chloroplastic OS=Arabidopsis thaliana GN=ABCI6 PE=1 SV=1 813 986 3.0E-07
sp|A7ZLX1|LSRA_ECO24 Putative autoinducer 2 import ATP-binding protein LsrA homolog OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lsrA PE=5 SV=1 802 1014 3.0E-07
sp|Q3KBH4|POTA_PSEPF Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1 140 347 3.0E-07
sp|Q8Z5N5|CBIO_SALTI Cobalt import ATP-binding protein CbiO OS=Salmonella typhi GN=cbiO PE=3 SV=1 815 1015 3.0E-07
sp|P77268|DDPD_ECOLI Probable D,D-dipeptide transport ATP-binding protein DdpD OS=Escherichia coli (strain K12) GN=ddpD PE=2 SV=1 793 1028 3.0E-07
sp|Q3SQ65|HMUV_NITWN Hemin import ATP-binding protein HmuV OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=hmuV PE=3 SV=1 815 1021 3.0E-07
sp|Q5E5I1|HMUV_VIBF1 Hemin import ATP-binding protein HmuV OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=hmuV PE=3 SV=1 145 352 3.0E-07
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 814 1012 4.0E-07
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 816 1005 4.0E-07
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 156 358 4.0E-07
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 156 380 4.0E-07
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 153 404 4.0E-07
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 823 1005 4.0E-07
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 826 1005 4.0E-07
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 823 1005 4.0E-07
sp|Q1WSB9|ECFA2_LACS1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus salivarius (strain UCC118) GN=ecfA2 PE=3 SV=1 823 1009 4.0E-07
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 156 358 4.0E-07
sp|A1URR2|UGPC_BARBK sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ugpC PE=3 SV=1 823 1005 4.0E-07
sp|Q4KFA2|LOLD_PSEF5 Lipoprotein-releasing system ATP-binding protein LolD OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=lolD PE=3 SV=2 140 344 4.0E-07
sp|Q0S0Z3|FBPC2_RHOJR Fe(3+) ions import ATP-binding protein FbpC 2 OS=Rhodococcus jostii (strain RHA1) GN=fbpC2 PE=3 SV=1 815 1012 4.0E-07
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 823 1005 4.0E-07
sp|Q92L55|CCMA_RHIME Cytochrome c biogenesis ATP-binding export protein CcmA OS=Rhizobium meliloti (strain 1021) GN=ccmA PE=3 SV=1 131 297 4.0E-07
sp|O28882|LIVF_ARCFU Probable branched-chain amino acid transport ATP-binding protein LivF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=livF PE=3 SV=1 130 351 4.0E-07
sp|Q66FU4|UGPC_YERPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ugpC PE=3 SV=1 156 358 4.0E-07
sp|A3DJK3|ECFA1_CLOTH Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ecfA1 PE=3 SV=2 152 347 4.0E-07
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 823 1005 4.0E-07
sp|Q6LN52|METN_PHOPR Methionine import ATP-binding protein MetN OS=Photobacterium profundum GN=metN PE=3 SV=2 146 355 4.0E-07
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 763 1005 4.0E-07
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 819 1005 4.0E-07
sp|Q97N51|ECFA2_STRPN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ecfA2 PE=3 SV=1 816 1005 4.0E-07
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 144 358 4.0E-07
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 814 1012 5.0E-07
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 814 1012 5.0E-07
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 144 347 5.0E-07
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 819 1005 5.0E-07
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 819 1005 5.0E-07
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 144 358 5.0E-07
sp|A3CVD3|ECFA_METMJ Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ecfA PE=3 SV=1 816 1005 5.0E-07
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 826 1013 5.0E-07
sp|Q1MAA2|RGMG_RHIL3 Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=RL4654 PE=3 SV=1 793 1014 5.0E-07
sp|Q8XAY7|LSRA_ECO57 Autoinducer 2 import ATP-binding protein LsrA OS=Escherichia coli O157:H7 GN=lsrA PE=3 SV=1 802 1014 5.0E-07
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 815 986 5.0E-07
sp|Q8DWR4|ECFA2_STRA5 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=ecfA2 PE=3 SV=1 814 1013 5.0E-07
sp|Q8E2L3|ECFA2_STRA3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=ecfA2 PE=3 SV=1 814 1013 5.0E-07
sp|Q3JYF5|ECFA2_STRA1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=ecfA2 PE=3 SV=1 814 1013 5.0E-07
sp|Q3Z5U5|THIQ_SHISS Thiamine import ATP-binding protein ThiQ OS=Shigella sonnei (strain Ss046) GN=thiQ PE=3 SV=1 156 351 5.0E-07
sp|Q13FD9|RGMG_BURXL Putative ribose/galactose/methyl galactoside import ATP-binding protein OS=Burkholderia xenovorans (strain LB400) GN=Bxeno_C1272 PE=3 SV=1 826 1060 5.0E-07
sp|Q62GB4|UGPC_BURMA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia mallei (strain ATCC 23344) GN=ugpC PE=3 SV=1 805 1005 5.0E-07
sp|Q1LC89|HMUV_CUPMC Hemin import ATP-binding protein HmuV OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hmuV PE=3 SV=1 137 351 5.0E-07
sp|Q82HA2|Y3608_STRAW Putative ABC transporter ATP-binding protein SAV_3608 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_3608 PE=3 SV=1 816 981 5.0E-07
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 146 366 5.0E-07
sp|Q8RD07|Y246_CALS4 Putative ABC transporter ATP-binding protein TTE0246 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0246 PE=3 SV=1 146 344 5.0E-07
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 153 367 5.0E-07
sp|Q9K789|METN_BACHD Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1 156 348 5.0E-07
sp|Q8UAK2|RGMG2_AGRFC Putative ribose/galactose/methyl galactoside import ATP-binding protein 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu3371 PE=3 SV=2 793 1014 5.0E-07
sp|Q8PSR0|Y3016_METMA Putative ABC transporter ATP-binding protein MM_3016 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_3016 PE=3 SV=1 767 1005 6.0E-07
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 823 1012 6.0E-07
sp|Q8PVG9|Y1996_METMA Putative ABC transporter ATP-binding protein MM_1996 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1996 PE=3 SV=1 794 1005 6.0E-07
sp|Q4QP85|FBPC_HAEI8 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus influenzae (strain 86-028NP) GN=fbpC PE=3 SV=1 813 1005 6.0E-07
sp|P74981|HMUV_YEREN Hemin import ATP-binding protein HmuV OS=Yersinia enterocolitica GN=hmuV PE=1 SV=2 813 1009 6.0E-07
sp|Q0HVQ0|LOLD_SHESR Lipoprotein-releasing system ATP-binding protein LolD OS=Shewanella sp. (strain MR-7) GN=lolD PE=3 SV=2 812 1005 6.0E-07
sp|Q98DT6|SSUB1_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhizobium loti (strain MAFF303099) GN=ssuB1 PE=3 SV=1 156 342 6.0E-07
sp|Q2NVW9|THIQ_SODGM Thiamine import ATP-binding protein ThiQ OS=Sodalis glossinidius (strain morsitans) GN=thiQ PE=3 SV=1 156 350 6.0E-07
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 823 1020 6.0E-07
sp|Q2P7S3|METN_XANOM Methionine import ATP-binding protein MetN OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=metN PE=3 SV=1 155 399 6.0E-07
sp|Q3JSI8|RBSA1_BURP1 Ribose import ATP-binding protein RbsA 1 OS=Burkholderia pseudomallei (strain 1710b) GN=rbsA1 PE=3 SV=1 766 1014 6.0E-07
sp|Q8ZKQ4|LSRA_SALTY Autoinducer 2 import ATP-binding protein LsrA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lsrA PE=1 SV=1 814 1014 6.0E-07
sp|Q1CNC6|UGPC_YERPN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ugpC PE=3 SV=1 156 358 6.0E-07
sp|Q74R28|UGPC_YERPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis GN=ugpC PE=3 SV=1 156 358 6.0E-07
sp|Q1CBH2|UGPC_YERPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ugpC PE=3 SV=1 156 358 6.0E-07
sp|Q13TV1|UGPC_BURXL sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia xenovorans (strain LB400) GN=ugpC PE=3 SV=1 156 398 6.0E-07
sp|Q11C01|RBSA_CHESB Ribose import ATP-binding protein RbsA OS=Chelativorans sp. (strain BNC1) GN=rbsA PE=3 SV=1 816 1009 6.0E-07
sp|Q0T4L9|LSRA_SHIF8 Autoinducer 2 import ATP-binding protein LsrA OS=Shigella flexneri serotype 5b (strain 8401) GN=lsrA PE=3 SV=1 802 1014 6.0E-07
sp|Q8XA06|THIQ_ECO57 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O157:H7 GN=thiQ PE=3 SV=1 156 351 6.0E-07
sp|P0C886|LSRA_SALCH Autoinducer 2 import ATP-binding protein LsrA OS=Salmonella choleraesuis (strain SC-B67) GN=lsrA PE=3 SV=1 814 1014 6.0E-07
sp|Q2K1C8|UGPC3_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC3 PE=3 SV=1 816 1012 6.0E-07
sp|A9MZG1|LSRA_SALPB Autoinducer 2 import ATP-binding protein LsrA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lsrA PE=3 SV=1 814 1014 6.0E-07
sp|Q5PJE7|LSRA_SALPA Autoinducer 2 import ATP-binding protein LsrA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lsrA PE=3 SV=1 814 1014 6.0E-07
sp|Q8PUE7|Y2387_METMA Putative ABC transporter ATP-binding protein MM_2387 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2387 PE=3 SV=1 816 987 6.0E-07
sp|F8DT93|LOLD_ZYMMA Lipoprotein-releasing system ATP-binding protein LolD OS=Zymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1) GN=lolD PE=3 SV=1 814 1005 6.0E-07
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 749 1005 7.0E-07
sp|Q62K91|RBSA_BURMA Ribose import ATP-binding protein RbsA OS=Burkholderia mallei (strain ATCC 23344) GN=rbsA PE=3 SV=1 793 1014 7.0E-07
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 131 341 7.0E-07
sp|Q0BGD7|RGMG1_BURCM Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=Bamb_1228 PE=3 SV=1 779 1022 7.0E-07
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 828 1005 8.0E-07
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 816 974 9.0E-07
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 825 1005 9.0E-07
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 131 350 1.0E-06
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 146 342 1.0E-06
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 145 338 1.0E-06
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 811 1005 2.0E-06
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 138 351 2.0E-06
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 801 974 2.0E-06
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 804 1006 2.0E-06
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 814 1005 2.0E-06
sp|Q8PUE7|Y2387_METMA Putative ABC transporter ATP-binding protein MM_2387 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_2387 PE=3 SV=1 129 344 2.0E-06
sp|Q8E7N9|RBSA_STRA3 Ribose import ATP-binding protein RbsA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rbsA PE=3 SV=1 789 1005 3.0E-06
sp|P73450|NRTC_SYNY3 Nitrate transport ATP-binding protein NrtC OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=nrtC PE=3 SV=1 146 351 3.0E-06
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 823 1006 4.0E-06
sp|Q9KN37|RBSA_VIBCH Ribose import ATP-binding protein RbsA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rbsA PE=3 SV=1 155 359 4.0E-06
sp|Q6HBS0|METN2_BACHK Methionine import ATP-binding protein MetN 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN2 PE=3 SV=1 156 348 4.0E-06
sp|Q8TSC8|Y870_METAC Putative ABC transporter ATP-binding protein MA_0870 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_0870 PE=3 SV=1 811 1013 4.0E-06
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 420 726 5.0E-06
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 146 366 5.0E-06
sp|Q1LC89|HMUV_CUPMC Hemin import ATP-binding protein HmuV OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=hmuV PE=3 SV=1 808 1026 5.0E-06
sp|Q5MZ54|CMPC_SYNP6 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpC PE=3 SV=1 154 341 6.0E-06
sp|Q55107|CMPC_SYNE7 Bicarbonate transport ATP-binding protein CmpC OS=Synechococcus elongatus (strain PCC 7942) GN=cmpC PE=1 SV=1 154 341 6.0E-06
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 154 342 6.0E-06
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 156 348 6.0E-06
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 156 348 6.0E-06
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 156 348 6.0E-06
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 156 348 6.0E-06
sp|Q9WY65|ECFA2_THEMA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA2 PE=1 SV=1 813 1008 7.0E-06
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 153 341 7.0E-06
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 816 1005 7.0E-06
sp|Q97JB8|Y1368_CLOAB Putative ABC transporter ATP-binding protein CA_C1368 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1368 PE=3 SV=1 146 351 7.0E-06
sp|Q13TV1|UGPC_BURXL sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Burkholderia xenovorans (strain LB400) GN=ugpC PE=3 SV=1 805 1005 7.0E-06
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 138 380 8.0E-06
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 146 342 9.0E-06
sp|Q7NRX5|UGPC_CHRVO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ugpC PE=3 SV=1 810 1005 9.0E-06
sp|Q93SH7|HMUV_BRADU Hemin import ATP-binding protein HmuV OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hmuV PE=3 SV=1 809 1021 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005524 ATP binding Yes
GO:0042626 ATPase-coupled transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0140657 ATP-dependent activity No
GO:0032555 purine ribonucleotide binding No
GO:0051179 localization No
GO:0030554 adenyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0006810 transport No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0031224 intrinsic component of membrane No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0022804 active transmembrane transporter activity No
GO:0043167 ion binding No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:0005215 transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.45

Transmembrane Domains

Domain # Start End Length
1 458 477 19
2 489 511 22
3 531 553 22
4 565 587 22
5 597 616 19
6 623 642 19
7 705 727 22
8 1121 1143 22
9 1153 1175 22
10 1207 1229 22
11 1234 1256 22
12 1269 1291 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3183
MPDHKHEEKVEPGRGSTSTERHRSYRGGTARGRQAEAVSVEQAVAEYEDLERELSRKNRIKDDVDVEKGAVDDGA
SDELDLETAFGCGLASQHVGVCWDRVTVRGVAAATNYVETLPDALLRLVDAVTPLMRLAGLCSRPAEAKLLSDIR
GVCRPGEMVLVLGKPGAGCSTLLRVVANQRRGFTAVDGSVRYGPWPASDFGRAEAVYNAEEDAHLATLTVEQTLA
FALDVTVPGATPGSRQRVLDMLLRIFNMEHARTTAVGHLSGGERRRVSMAEMMVTRACVQCWDNSTRGLDASTAL
DFVRSLRVQTDLYRTATLVSLYQASESIYRLFDRVLVLAEGRQVYFGPAAEARAYFDGLGFVPASPRQTTADYLV
ACADGPDPDALSESFGRSAAGARLEADLTAYLGECHIQHGDDDDDNRKRPTRSAYRTPFRLQLWALARRQFALKL
QDRFNLTLSWVRSIVIALVLGSLYRSLGRTSASAFSRGGLLFGALFFNALQAFSELAGTMLGRAVVDKHRAYGFH
RPSALWIAQMAVDQAFAATEILAFSVVVYLMTELVRDAAAFFIFYLLLLSGNVAMTLVFRIIGCLSRDFDRAIRV
AVIVITLLVTTSGYMVQYEDEKPWLRWMSWLNVLGLIFGALMENEFGRIELSCAAESLVPSGPGYDDARHQVCTL
PGSRPGTLAVRGSDYIARAFSYRSGDMWRNWGIVAAVTIVFLLLNVVLGELVRFDGSSGSARVSLRPDDGERRAL
NERLEAAAAARRHQQGPHEEEQEEETVVETRPDPEVGPDVAPESVLAWQGLTYDVPTTCGRTKRLLAGIDGFVRR
GELTALMGASGAGKTTLLDVLVGRKTVGVVGGRIRQWSGRVAAYAEQQPLDEPTQTVREALRFSADLRQRRGIGQ
AERHAYVEHVLVMLEMEALADCIIGQGLTVEERKRVSIGVELAARPERLLFLDEPTSGLDSRGALNTVRLLRKLA
AAGLAVVCTIHQPDADLFGLFDRLLLMQRGGRVAYFGETGPDAAVVRGYFARHGAEPEPTDNVAEFMLEAVGAGS
GRRLGDRDWAEVWDDSPERAAVVETVSRLLRSEEAGIGGGGGAEPGSASVGRQLRVVTTRAIRSLWRSPDYVVTR
LLGQLAVALVSGLTFLGLDDSRASLQKTVFVMFQVTVVPALVIGQVEVLFHHRRAVAQRETAAGMYPPGVFAAAM
AAAEVPVSILCAGLFFSCIYLAPGLSLAAPRAGYQFLMILVTQLFSVSLGQAVAALTPSSRVAAQLDPLLVTVLA
LFCGVTMPASQMPALFRSWLHPLDPLTRLIGGMVTTALHGLPVRCRPNELSRFSAPEGVTCASYMSDFFAGGGRG
YLAGDDDGGTCEYCAYKVGDEFYGPLGMSFANRWRDLGIFAVFVVTNLVGI*
Coding >Ophun1|3183
ATGCCGGACCACAAGCACGAAGAAAAGGTTGAACCGGGACGGGGATCGACGTCGACGGAGCGCCATCGGTCGTAC
AGAGGCGGCACCGCAAGGGGACGGCAGGCCGAGGCCGTCTCAGTGGAGCAAGCGGTGGCCGAGTATGAAGACCTC
GAGCGCGAGCTGAGCCGCAAGAACCGGATTAAGGACGATGTCGATGTGGAAAAGGGGGCCGTGGACGATGGGGCG
TCGGATGAGCTGGATCTCGAGACGGCTTTTGGCTGCGGCCTCGCCTCGCAGCACGTTGGCGTCTGCTGGGATCGA
GTGACGGTCCGGGGCGTGGCGGCGGCGACCAACTACGTCGAGACGCTTCCCGACGCCCTGTTGCGGCTCGTCGAT
GCCGTGACGCCCCTGATGCGGCTCGCGGGTCTCTGCAGCCGGCCGGCCGAGGCAAAGCTGCTGAGCGACATCCGG
GGTGTGTGTCGGCCGGGAGAGATGGTTCTGGTACTGGGCAAGCCTGGCGCCGGCTGCTCGACGCTGCTCCGTGTC
GTGGCCAACCAGCGGCGCGGCTTCACGGCCGTCGACGGCTCAGTGCGGTACGGGCCGTGGCCAGCATCCGACTTT
GGCCGGGCCGAGGCCGTCTACAACGCCGAAGAGGATGCCCACCTGGCGACTCTGACGGTGGAGCAGACGTTGGCC
TTTGCTCTCGACGTGACGGTCCCTGGGGCGACTCCCGGTTCGCGTCAGCGCGTGCTCGACATGCTACTGCGAATC
TTCAACATGGAGCACGCCCGGACCACGGCTGTCGGACACCTATCGGGCGGCGAGCGGCGACGCGTGTCCATGGCG
GAGATGATGGTAACACGCGCCTGCGTTCAGTGCTGGGACAATAGCACGCGAGGCCTCGATGCCAGCACCGCCCTC
GACTTTGTGCGCTCGCTGCGTGTCCAGACAGACCTTTACCGGACTGCCACCCTTGTGTCGCTATATCAGGCTTCG
GAGAGCATCTACCGTCTGTTCGACCGCGTTCTGGTTCTCGCAGAGGGCCGCCAGGTCTACTTTGGCCCGGCTGCC
GAGGCCAGGGCTTACTTTGATGGCCTTGGCTTCGTCCCGGCAAGTCCTAGACAAACGACGGCCGACTATCTGGTT
GCCTGCGCCGACGGACCGGATCCGGACGCTCTGAGTGAATCCTTTGGCCGGTCCGCGGCCGGAGCTCGTCTCGAG
GCGGACCTGACCGCTTACCTCGGCGAGTGTCATATCCAACATGGTGACGACGATGACGACAACAGAAAGCGGCCC
ACACGCTCCGCCTACCGGACGCCCTTTCGGCTGCAGTTGTGGGCTCTTGCTAGGCGGCAGTTTGCCCTCAAGCTA
CAGGACCGATTCAACCTGACGCTCTCGTGGGTGCGGAGCATCGTCATCGCCCTCGTCCTCGGCTCGCTGTATCGC
AGCCTGGGCCGGACGTCGGCCAGTGCCTTCAGTCGCGGCGGCTTGCTCTTCGGCGCCCTCTTCTTTAACGCGCTG
CAGGCATTTTCCGAGCTGGCTGGCACGATGCTGGGACGGGCCGTCGTCGACAAGCACCGGGCTTACGGCTTTCAC
CGGCCGTCGGCACTCTGGATCGCCCAGATGGCCGTCGATCAGGCCTTTGCGGCGACGGAGATTCTAGCTTTTAGT
GTTGTCGTCTATCTCATGACGGAGCTCGTCCGTGACGCCGCCGCCTTCTTTATCTTTTATCTTCTCCTGCTGTCG
GGCAACGTGGCCATGACGCTCGTCTTCCGCATCATCGGATGCCTCAGCCGCGACTTTGACCGTGCCATCCGCGTG
GCCGTCATCGTCATTACGCTCTTGGTCACGACGTCTGGCTACATGGTGCAGTACGAGGACGAGAAGCCGTGGCTG
CGCTGGATGTCGTGGCTCAACGTTCTGGGTCTCATCTTTGGCGCCCTGATGGAGAATGAGTTTGGCCGGATCGAG
CTCAGTTGCGCGGCCGAGTCACTCGTGCCGTCTGGCCCGGGTTATGATGATGCGCGTCATCAGGTGTGCACGCTG
CCGGGCTCGAGGCCGGGGACGCTGGCCGTTCGGGGTAGCGACTATATCGCCCGGGCCTTTTCGTATCGGTCCGGC
GATATGTGGCGGAACTGGGGCATCGTGGCCGCCGTCACCATTGTCTTCTTGCTGCTCAACGTGGTGCTGGGCGAG
TTGGTGCGCTTCGATGGTTCCAGCGGTTCTGCGCGAGTATCGCTGCGGCCTGACGACGGCGAGCGGCGCGCACTG
AACGAGCGGCTGGAAGCGGCGGCGGCGGCCCGGCGGCATCAGCAGGGCCCGCACGAGGAGGAACAGGAGGAGGAG
ACGGTGGTGGAAACCCGGCCGGACCCGGAGGTCGGACCGGACGTGGCCCCTGAAAGCGTTCTCGCGTGGCAGGGG
CTCACATACGACGTGCCGACGACATGCGGCCGTACCAAACGACTGCTCGCCGGCATTGACGGCTTCGTTCGACGG
GGCGAGCTAACGGCTCTCATGGGCGCGTCTGGTGCGGGCAAGACAACGCTGCTGGACGTGCTGGTGGGCCGCAAG
ACGGTCGGTGTCGTCGGCGGCCGTATCCGGCAGTGGTCCGGACGGGTGGCGGCTTACGCCGAACAGCAGCCGCTG
GACGAGCCGACGCAGACGGTGCGGGAGGCTCTGCGCTTCTCGGCCGACCTGCGACAGCGGCGCGGCATCGGACAG
GCGGAGCGGCACGCCTACGTCGAGCACGTGCTGGTCATGCTGGAGATGGAGGCCCTCGCCGACTGCATCATCGGC
CAGGGGCTCACGGTGGAGGAGCGCAAACGGGTGTCCATCGGAGTCGAGCTGGCGGCCCGACCGGAACGTCTGCTA
TTCCTGGACGAGCCGACGTCCGGACTCGACAGCCGAGGTGCGCTCAACACGGTCCGGCTGCTACGGAAGCTGGCG
GCGGCGGGCCTGGCCGTGGTGTGCACCATCCATCAGCCTGACGCCGACCTGTTTGGCCTGTTCGACAGGCTACTG
CTGATGCAGAGGGGAGGCCGCGTCGCCTACTTTGGCGAAACGGGCCCGGACGCGGCCGTTGTGAGAGGCTATTTC
GCCCGGCACGGGGCCGAGCCGGAGCCGACGGACAACGTGGCAGAGTTCATGCTCGAGGCCGTCGGCGCCGGCAGC
GGACGACGGCTCGGTGACCGCGACTGGGCCGAAGTGTGGGACGATAGCCCCGAACGGGCAGCCGTGGTCGAGACC
GTGAGCCGGCTGCTGCGGTCGGAAGAGGCCGGGATCGGAGGCGGTGGTGGGGCCGAACCCGGATCGGCGTCGGTG
GGGCGGCAGCTCCGGGTGGTGACGACACGGGCGATACGATCCCTCTGGCGGTCACCGGATTACGTGGTGACACGG
CTACTGGGCCAGCTGGCAGTGGCTCTCGTCAGCGGACTGACGTTCCTCGGCCTGGACGACTCGCGGGCCTCGCTG
CAGAAGACGGTCTTCGTCATGTTCCAGGTGACGGTGGTTCCGGCCCTCGTCATCGGCCAGGTCGAAGTGCTCTTC
CACCACAGACGGGCCGTGGCTCAACGGGAGACGGCGGCCGGAATGTATCCCCCGGGGGTATTCGCAGCGGCCATG
GCAGCAGCCGAGGTGCCCGTCTCGATCCTCTGCGCCGGCCTCTTCTTCTCGTGCATCTACCTGGCGCCAGGCCTG
TCACTAGCAGCCCCACGAGCAGGCTACCAATTCCTCATGATCCTCGTCACGCAACTCTTCTCCGTCTCGCTGGGC
CAGGCAGTAGCCGCTCTGACGCCCTCATCGCGGGTAGCCGCCCAGCTAGACCCCCTGCTCGTCACCGTCCTAGCC
CTCTTCTGCGGCGTCACGATGCCGGCTTCACAGATGCCAGCGCTCTTCCGGTCCTGGCTACACCCTCTCGATCCG
CTAACGAGGCTCATTGGCGGCATGGTGACGACGGCGCTGCACGGACTGCCGGTACGGTGTCGACCGAACGAACTG
AGTCGCTTCTCGGCGCCCGAGGGAGTGACGTGCGCGTCATACATGTCTGATTTCTTTGCTGGAGGGGGAAGGGGC
TATCTCGCCGGTGACGACGACGGGGGCACGTGCGAGTACTGCGCTTACAAAGTCGGAGATGAGTTTTACGGGCCG
TTGGGCATGTCTTTCGCCAACCGGTGGCGCGATCTAGGTATCTTTGCCGTGTTTGTGGTTACGAATTTGGTCGGT
ATTTGA
Transcript >Ophun1|3183
ATGCCGGACCACAAGCACGAAGAAAAGGTTGAACCGGGACGGGGATCGACGTCGACGGAGCGCCATCGGTCGTAC
AGAGGCGGCACCGCAAGGGGACGGCAGGCCGAGGCCGTCTCAGTGGAGCAAGCGGTGGCCGAGTATGAAGACCTC
GAGCGCGAGCTGAGCCGCAAGAACCGGATTAAGGACGATGTCGATGTGGAAAAGGGGGCCGTGGACGATGGGGCG
TCGGATGAGCTGGATCTCGAGACGGCTTTTGGCTGCGGCCTCGCCTCGCAGCACGTTGGCGTCTGCTGGGATCGA
GTGACGGTCCGGGGCGTGGCGGCGGCGACCAACTACGTCGAGACGCTTCCCGACGCCCTGTTGCGGCTCGTCGAT
GCCGTGACGCCCCTGATGCGGCTCGCGGGTCTCTGCAGCCGGCCGGCCGAGGCAAAGCTGCTGAGCGACATCCGG
GGTGTGTGTCGGCCGGGAGAGATGGTTCTGGTACTGGGCAAGCCTGGCGCCGGCTGCTCGACGCTGCTCCGTGTC
GTGGCCAACCAGCGGCGCGGCTTCACGGCCGTCGACGGCTCAGTGCGGTACGGGCCGTGGCCAGCATCCGACTTT
GGCCGGGCCGAGGCCGTCTACAACGCCGAAGAGGATGCCCACCTGGCGACTCTGACGGTGGAGCAGACGTTGGCC
TTTGCTCTCGACGTGACGGTCCCTGGGGCGACTCCCGGTTCGCGTCAGCGCGTGCTCGACATGCTACTGCGAATC
TTCAACATGGAGCACGCCCGGACCACGGCTGTCGGACACCTATCGGGCGGCGAGCGGCGACGCGTGTCCATGGCG
GAGATGATGGTAACACGCGCCTGCGTTCAGTGCTGGGACAATAGCACGCGAGGCCTCGATGCCAGCACCGCCCTC
GACTTTGTGCGCTCGCTGCGTGTCCAGACAGACCTTTACCGGACTGCCACCCTTGTGTCGCTATATCAGGCTTCG
GAGAGCATCTACCGTCTGTTCGACCGCGTTCTGGTTCTCGCAGAGGGCCGCCAGGTCTACTTTGGCCCGGCTGCC
GAGGCCAGGGCTTACTTTGATGGCCTTGGCTTCGTCCCGGCAAGTCCTAGACAAACGACGGCCGACTATCTGGTT
GCCTGCGCCGACGGACCGGATCCGGACGCTCTGAGTGAATCCTTTGGCCGGTCCGCGGCCGGAGCTCGTCTCGAG
GCGGACCTGACCGCTTACCTCGGCGAGTGTCATATCCAACATGGTGACGACGATGACGACAACAGAAAGCGGCCC
ACACGCTCCGCCTACCGGACGCCCTTTCGGCTGCAGTTGTGGGCTCTTGCTAGGCGGCAGTTTGCCCTCAAGCTA
CAGGACCGATTCAACCTGACGCTCTCGTGGGTGCGGAGCATCGTCATCGCCCTCGTCCTCGGCTCGCTGTATCGC
AGCCTGGGCCGGACGTCGGCCAGTGCCTTCAGTCGCGGCGGCTTGCTCTTCGGCGCCCTCTTCTTTAACGCGCTG
CAGGCATTTTCCGAGCTGGCTGGCACGATGCTGGGACGGGCCGTCGTCGACAAGCACCGGGCTTACGGCTTTCAC
CGGCCGTCGGCACTCTGGATCGCCCAGATGGCCGTCGATCAGGCCTTTGCGGCGACGGAGATTCTAGCTTTTAGT
GTTGTCGTCTATCTCATGACGGAGCTCGTCCGTGACGCCGCCGCCTTCTTTATCTTTTATCTTCTCCTGCTGTCG
GGCAACGTGGCCATGACGCTCGTCTTCCGCATCATCGGATGCCTCAGCCGCGACTTTGACCGTGCCATCCGCGTG
GCCGTCATCGTCATTACGCTCTTGGTCACGACGTCTGGCTACATGGTGCAGTACGAGGACGAGAAGCCGTGGCTG
CGCTGGATGTCGTGGCTCAACGTTCTGGGTCTCATCTTTGGCGCCCTGATGGAGAATGAGTTTGGCCGGATCGAG
CTCAGTTGCGCGGCCGAGTCACTCGTGCCGTCTGGCCCGGGTTATGATGATGCGCGTCATCAGGTGTGCACGCTG
CCGGGCTCGAGGCCGGGGACGCTGGCCGTTCGGGGTAGCGACTATATCGCCCGGGCCTTTTCGTATCGGTCCGGC
GATATGTGGCGGAACTGGGGCATCGTGGCCGCCGTCACCATTGTCTTCTTGCTGCTCAACGTGGTGCTGGGCGAG
TTGGTGCGCTTCGATGGTTCCAGCGGTTCTGCGCGAGTATCGCTGCGGCCTGACGACGGCGAGCGGCGCGCACTG
AACGAGCGGCTGGAAGCGGCGGCGGCGGCCCGGCGGCATCAGCAGGGCCCGCACGAGGAGGAACAGGAGGAGGAG
ACGGTGGTGGAAACCCGGCCGGACCCGGAGGTCGGACCGGACGTGGCCCCTGAAAGCGTTCTCGCGTGGCAGGGG
CTCACATACGACGTGCCGACGACATGCGGCCGTACCAAACGACTGCTCGCCGGCATTGACGGCTTCGTTCGACGG
GGCGAGCTAACGGCTCTCATGGGCGCGTCTGGTGCGGGCAAGACAACGCTGCTGGACGTGCTGGTGGGCCGCAAG
ACGGTCGGTGTCGTCGGCGGCCGTATCCGGCAGTGGTCCGGACGGGTGGCGGCTTACGCCGAACAGCAGCCGCTG
GACGAGCCGACGCAGACGGTGCGGGAGGCTCTGCGCTTCTCGGCCGACCTGCGACAGCGGCGCGGCATCGGACAG
GCGGAGCGGCACGCCTACGTCGAGCACGTGCTGGTCATGCTGGAGATGGAGGCCCTCGCCGACTGCATCATCGGC
CAGGGGCTCACGGTGGAGGAGCGCAAACGGGTGTCCATCGGAGTCGAGCTGGCGGCCCGACCGGAACGTCTGCTA
TTCCTGGACGAGCCGACGTCCGGACTCGACAGCCGAGGTGCGCTCAACACGGTCCGGCTGCTACGGAAGCTGGCG
GCGGCGGGCCTGGCCGTGGTGTGCACCATCCATCAGCCTGACGCCGACCTGTTTGGCCTGTTCGACAGGCTACTG
CTGATGCAGAGGGGAGGCCGCGTCGCCTACTTTGGCGAAACGGGCCCGGACGCGGCCGTTGTGAGAGGCTATTTC
GCCCGGCACGGGGCCGAGCCGGAGCCGACGGACAACGTGGCAGAGTTCATGCTCGAGGCCGTCGGCGCCGGCAGC
GGACGACGGCTCGGTGACCGCGACTGGGCCGAAGTGTGGGACGATAGCCCCGAACGGGCAGCCGTGGTCGAGACC
GTGAGCCGGCTGCTGCGGTCGGAAGAGGCCGGGATCGGAGGCGGTGGTGGGGCCGAACCCGGATCGGCGTCGGTG
GGGCGGCAGCTCCGGGTGGTGACGACACGGGCGATACGATCCCTCTGGCGGTCACCGGATTACGTGGTGACACGG
CTACTGGGCCAGCTGGCAGTGGCTCTCGTCAGCGGACTGACGTTCCTCGGCCTGGACGACTCGCGGGCCTCGCTG
CAGAAGACGGTCTTCGTCATGTTCCAGGTGACGGTGGTTCCGGCCCTCGTCATCGGCCAGGTCGAAGTGCTCTTC
CACCACAGACGGGCCGTGGCTCAACGGGAGACGGCGGCCGGAATGTATCCCCCGGGGGTATTCGCAGCGGCCATG
GCAGCAGCCGAGGTGCCCGTCTCGATCCTCTGCGCCGGCCTCTTCTTCTCGTGCATCTACCTGGCGCCAGGCCTG
TCACTAGCAGCCCCACGAGCAGGCTACCAATTCCTCATGATCCTCGTCACGCAACTCTTCTCCGTCTCGCTGGGC
CAGGCAGTAGCCGCTCTGACGCCCTCATCGCGGGTAGCCGCCCAGCTAGACCCCCTGCTCGTCACCGTCCTAGCC
CTCTTCTGCGGCGTCACGATGCCGGCTTCACAGATGCCAGCGCTCTTCCGGTCCTGGCTACACCCTCTCGATCCG
CTAACGAGGCTCATTGGCGGCATGGTGACGACGGCGCTGCACGGACTGCCGGTACGGTGTCGACCGAACGAACTG
AGTCGCTTCTCGGCGCCCGAGGGAGTGACGTGCGCGTCATACATGTCTGATTTCTTTGCTGGAGGGGGAAGGGGC
TATCTCGCCGGTGACGACGACGGGGGCACGTGCGAGTACTGCGCTTACAAAGTCGGAGATGAGTTTTACGGGCCG
TTGGGCATGTCTTTCGCCAACCGGTGGCGCGATCTAGGTATCTTTGCCGTGTTTGTGGTTACGAATTTGGTCGGT
ATTTGA
Gene >Ophun1|3183
ATGCCGGACCACAAGCACGAAGAAAAGGTTGAACCGGGACGGGGATCGACGTCGACGGAGCGCCATCGGTCGTAC
AGAGGCGGCACCGCAAGGGGACGGCAGGCCGAGGCCGTCTCAGTGGAGCAAGCGGTGGCCGAGTATGAAGACCTC
GAGCGCGAGCTGAGCCGCAAGAACCGGATTAAGGACGATGTCGATGTGGAAAAGGGGGCCGTGGACGATGGGGCG
TCGGATGAGCTGGATCTCGAGACGGCTTTTGGCTGCGGCCTCGCCTCGCAGCACGTTGGCGTCTGCTGGGATCGA
GTGACGGTCCGGGGCGTGGCGGCGGCGACCAACTACGTCGAGACGCTTCCCGACGCCCTGTTGCGGCTCGTCGAT
GCCGTGACGCCCCTGATGCGGCTCGCGGGTCTCTGCAGCCGGCCGGCCGAGGCAAAGCTGCTGAGCGACATCCGG
GGTGTGTGTCGGCCGGGAGAGATGGTTCTGGTACTGGGCAAGCCTGGCGCCGGCTGCTCGACGCTGCTCCGTGTC
GTGGCCAACCAGCGGCGCGGCTTCACGGCCGTCGACGGCTCAGTGCGGTACGGGCCGTGGCCAGCATCCGACTTT
GGCCGGGCCGAGGCCGTCTACAACGCCGAAGAGGATGCCCACCTGGCGACTCTGACGGTGGAGCAGACGTTGGCC
TTTGCTCTCGACGTGACGGTCCCTGGGGCGACTCCCGGTTCGCGTCAGCGCGTGCTCGACATGCTACTGCGAATC
TTCAACATGGAGCACGCCCGGACCACGGCTGTCGGACACCTATCGGGCGGCGAGCGGCGACGCGTGTCCATGGCG
GAGATGATGGTAACACGCGCCTGCGTTCAGTGCTGGGACAATAGCACGCGAGGCCTCGATGCCAGCACCGCCCTC
GACTTTGTGCGCTCGCTGCGTGTCCAGACAGACCTTTACCGGACTGCCACCCTTGTGTCGCTATATCAGGCTTCG
GAGAGCATCTACCGTCTGTTCGACCGCGTTCTGGTTCTCGCAGAGGGCCGCCAGGTCTACTTTGGCCCGGCTGCC
GAGGCCAGGGCTTACTTTGATGGCCTTGGCTTCGTCCCGGCAAGTCCTAGACAAACGACGGCCGACTATCTGGTT
GCCTGCGCCGACGGACCGGATCCGGACGCTCTGAGTGAATCCTTTGGCCGGTCCGCGGCCGGAGCTCGTCTCGAG
GCGGACCTGACCGCTTACCTCGGCGAGTGTCATATCCAACATGGTGACGACGATGACGACAACAGAAAGCGGCCC
ACACGCTCCGCCTACCGGACGCCCTTTCGGCTGCAGTTGTGGGCTCTTGCTAGGCGGCAGTTTGCCCTCAAGCTA
CAGGACCGATTCAACCTGACGCTCTCGTGGGTGCGGAGCATCGTCATCGCCCTCGTCCTCGGCTCGCTGTATCGC
AGCCTGGGCCGGACGTCGGCCAGTGCCTTCAGTCGCGGCGGCTTGCTCTTCGGCGCCCTCTTCTTTAACGCGCTG
CAGGCATTTTCCGAGCTGGCTGGCACGATGCTGGGACGGGCCGTCGTCGACAAGCACCGGGCTTACGGCTTTCAC
CGGCCGTCGGCACTCTGGATCGCCCAGATGGCCGTCGATCAGGCCTTTGCGGCGACGGAGATTCTAGCTTTTAGT
GTTGTCGTCTATCTCATGACGGAGCTCGTCCGTGACGCCGCCGCCTTCTTTATCTTTTATCTTCTCCTGCTGTCG
GGCAACGTGGCCATGACGCTCGTCTTCCGCATCATCGGATGCCTCAGCCGCGACTTTGACCGTGCCATCCGCGTG
GCCGTCATCGTCATTACGCTCTTGGTCACGACGTCTGGCTACATGGTGCAGTACGAGGACGAGAAGCCGTGGCTG
CGCTGGATGTCGTGGCTCAACGTTCTGGGTCTCATCTTTGGCGCCCTGATGGAGAATGAGTTTGGCCGGATCGAG
CTCAGTTGCGCGGCCGAGTCACTCGTGCCGTCTGGCCCGGGTTATGATGATGCGCGTCATCAGGTGTGCACGCTG
CCGGGCTCGAGGCCGGGGACGCTGGCCGTTCGGGGTAGCGACTATATCGCCCGGGCCTTTTCGTATCGGTCCGGC
GATATGTGGCGGAACTGGGGCATCGTGGCCGCCGTCACCATTGTCTTCTTGCTGCTCAACGTGGTGCTGGGCGAG
TTGGTGCGCTTCGATGGTTCCAGCGGTTCTGCGCGAGTATCGCTGCGGCCTGACGACGGCGAGCGGCGCGCACTG
AACGAGCGGCTGGAAGCGGCGGCGGCGGCCCGGCGGCATCAGCAGGGCCCGCACGAGGAGGAACAGGAGGAGGAG
ACGGTGGTGGAAACCCGGCCGGACCCGGAGGTCGGACCGGACGTGGCCCCTGAAAGCGTTCTCGCGTGGCAGGGG
CTCACATACGACGTGCCGACGACATGCGGCCGTACCAAACGACTGCTCGCCGGCATTGACGGCTTCGTTCGACGG
GGCGAGCTAACGGCTCTCATGGGCGCGTCTGGTGCGGGCAAGACAACGCTGCTGGACGTGCTGGTGGGCCGCAAG
ACGGTCGGTGTCGTCGGCGGCCGTATCCGGCAGTGGTCCGGACGGGTGGCGGCTTACGCCGAACAGCAGCCGCTG
GACGAGCCGACGCAGACGGTGCGGGAGGCTCTGCGCTTCTCGGCCGACCTGCGACAGCGGCGCGGCATCGGACAG
GCGGAGCGGCACGCCTACGTCGAGCACGTGCTGGTCATGCTGGAGATGGAGGCCCTCGCCGACTGCATCATCGGC
CAGGGGCTCACGGTGGAGGAGCGCAAACGGGTGTCCATCGGAGTCGAGCTGGCGGCCCGACCGGAACGTCTGCTA
TTCCTGGACGAGCCGACGTCCGGACTCGACAGCCGAGGTGCGCTCAACACGGTCCGGCTGCTACGGAAGCTGGCG
GCGGCGGGCCTGGCCGTGGTGTGCACCATCCATCAGCCTGACGCCGACCTGTTTGGCCTGTTCGACAGGCTACTG
CTGATGCAGAGGGGAGGCCGCGTCGCCTACTTTGGCGAAACGGGCCCGGACGCGGCCGTTGTGAGAGGCTATTTC
GCCCGGCACGGGGCCGAGCCGGAGCCGACGGACAACGTGGCAGAGTTCATGCTCGAGGCCGTCGGCGCCGGCAGC
GGACGACGGCTCGGTGACCGCGACTGGGCCGAAGTGTGGGACGATAGCCCCGAACGGGCAGCCGTGGTCGAGACC
GTGAGCCGGCTGCTGCGGTCGGAAGAGGCCGGGATCGGAGGCGGTGGTGGGGCCGAACCCGGATCGGCGTCGGTG
GGGCGGCAGCTCCGGGTGGTGACGACACGGGCGATACGATCCCTCTGGCGGTCACCGGATTACGTGGTGACACGG
CTACTGGGCCAGCTGGCAGTGGCTCTCGTCAGCGGACTGACGTTCCTCGGCCTGGACGACTCGCGGGCCTCGCTG
CAGAAGACGGTCTTCGTCATGTTCCAGGTGACGGTGGTTCCGGCCCTCGTCATCGGCCAGGTCGAAGTGCTCTTC
CACCACAGACGGGCCGTGGCTCAACGGGAGACGGCGGCCGGAATGTATCCCCCGGGGGTATTCGCAGCGGCCATG
GCAGCAGCCGAGGTGCCCGTCTCGATCCTCTGCGCCGGCCTCTTCTTCTCGTGCATCTACCTGGCGCCAGGCCTG
TCACTAGCAGCCCCACGAGCAGGCTACCAATTCCTCATGATCCTCGTCACGCAACTCTTCTCCGTCTCGCTGGGC
CAGGCAGTAGCCGCTCTGACGCCCTCATCGCGGGTAGCCGCCCAGCTAGACCCCCTGCTCGTCACCGTCCTAGCC
CTCTTCTGCGGCGTCACGATGCCGGCTTCACAGATGCCAGCGCTCTTCCGGTCCTGGCTACACCCTCTCGATCCG
CTAACGAGGCTCATTGGCGGCATGGTGACGACGGCGCTGCACGGACTGCCGGTACGGTGTCGACCGAACGAACTG
AGTCGCTTCTCGGCGCCCGAGGGAGTGACGTGCGCGTCATACATGTCTGATTTCTTTGCTGGAGGGGGAAGGGGC
TATCTCGCCGGTGACGACGACGGGGGCACGTGCGAGTACTGCGCTTACAAAGTCGGAGATGAGTTTTACGGGCCG
TTGGGCATGTCTTTCGCCAACCGGTGGCGCGATCTAGGTATCTTTGCCGTGTTTGTGGTTACGAATTTGGGTATT
GTCTTTGCAGCGGTGAGTTTATACCCCCCGCGAAGCTGGCTTTTGGTTACTGACGGACGGGTGGTGTAGAGTCGG
TATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail