Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3181
Gene name
LocationContig_282:21600..22232
Strand-
Gene length (bp)632
Transcript length (bp)567
Coding sequence length (bp)567
Protein length (aa) 189

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04749 PLAC8 PLAC8 family 5.3E-22 19 120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 12 147 9.0E-12
sp|P0CW97|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana GN=PCR3 PE=3 SV=1 12 147 3.0E-11
sp|Q9LQU2|PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana GN=PCR1 PE=1 SV=1 12 147 3.0E-08
sp|Q5REK4|PLAC8_PONAB Placenta-specific gene 8 protein OS=Pongo abelii GN=PLAC8 PE=3 SV=1 6 126 5.0E-08
sp|Q9LS43|PCR7_ARATH Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis thaliana GN=PCR7 PE=2 SV=1 16 143 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9LQU4|PCR2_ARATH Protein PLANT CADMIUM RESISTANCE 2 OS=Arabidopsis thaliana GN=PCR2 PE=1 SV=1 12 147 9.0E-12
sp|P0CW97|PCR3_ARATH Protein PLANT CADMIUM RESISTANCE 3 OS=Arabidopsis thaliana GN=PCR3 PE=3 SV=1 12 147 3.0E-11
sp|Q9LQU2|PCR1_ARATH Protein PLANT CADMIUM RESISTANCE 1 OS=Arabidopsis thaliana GN=PCR1 PE=1 SV=1 12 147 3.0E-08
sp|Q5REK4|PLAC8_PONAB Placenta-specific gene 8 protein OS=Pongo abelii GN=PLAC8 PE=3 SV=1 6 126 5.0E-08
sp|Q9LS43|PCR7_ARATH Protein PLANT CADMIUM RESISTANCE 7 OS=Arabidopsis thaliana GN=PCR7 PE=2 SV=1 16 143 6.0E-08
sp|D9HP26|CNR10_MAIZE Cell number regulator 10 OS=Zea mays GN=CNR10 PE=2 SV=1 6 140 7.0E-08
sp|Q6MW50|YB290_NEUCR Uncharacterized protein NCU10291 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B4B2.090 PE=4 SV=1 12 124 9.0E-08
sp|B6SJQ0|CNR13_MAIZE Cell number regulator 13 OS=Zea mays GN=CNR13 PE=2 SV=1 15 126 3.0E-07
sp|Q9NZF1|PLAC8_HUMAN Placenta-specific gene 8 protein OS=Homo sapiens GN=PLAC8 PE=2 SV=1 6 126 3.0E-07
sp|D9HP19|CNR3_MAIZE Cell number regulator 3 OS=Zea mays GN=CNR3 PE=2 SV=1 6 139 4.0E-07
sp|Q3ZCB2|PLAC8_BOVIN Placenta-specific gene 8 protein OS=Bos taurus GN=PLAC8 PE=3 SV=1 6 126 5.0E-07
sp|D9HP27|CNR11_MAIZE Cell number regulator 11 OS=Zea mays GN=CNR11 PE=2 SV=1 18 124 5.0E-07
sp|B4FF80|CNR5_MAIZE Cell number regulator 5 OS=Zea mays GN=CNR5 PE=2 SV=1 7 125 1.0E-06
sp|Q8S8T8|PCR10_ARATH Protein PLANT CADMIUM RESISTANCE 10 OS=Arabidopsis thaliana GN=PCR10 PE=2 SV=1 18 127 1.0E-06
sp|Q9SX26|PCR12_ARATH Protein PLANT CADMIUM RESISTANCE 12 OS=Arabidopsis thaliana GN=PCR12 PE=2 SV=2 19 143 3.0E-06
sp|Q9JI48|PLAC8_MOUSE Placenta-specific gene 8 protein OS=Mus musculus GN=Plac8 PE=1 SV=1 9 126 3.0E-06
sp|Q9LS44|PCR4_ARATH Protein PLANT CADMIUM RESISTANCE 4 OS=Arabidopsis thaliana GN=PCR4 PE=3 SV=1 10 124 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3648
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|766
Ophiocordyceps australis map64 (Brazil) OphauB2|4387
Ophiocordyceps camponoti-floridani Ophcf2|02278
Ophiocordyceps camponoti-rufipedis Ophun1|3181 (this protein)
Ophiocordyceps kimflemingae Ophio5|5101
Ophiocordyceps subramaniannii Hirsu2|7044

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3181
MENPPPNNGPLPQPHDDKWGSNLCNCSPCESCLLATFLPCMLSGRTATRMRDASMQSFSEINDECVIFGLIHGFT
GFGWVLSMIHRGEIRRRYGIKGNCCGDYCVSFWCLCCDLIQQDKEVRRRTAGLVTDGYDGNKERMYVPGAPAPAH
GYPQQPMMVSQQDEGMVYETGPQQEQQQQPPPSKETRG*
Coding >Ophun1|3181
ATGGAAAACCCACCGCCCAACAACGGCCCTCTTCCACAGCCTCACGACGACAAATGGGGCAGTAATCTATGCAAC
TGCTCGCCCTGCGAGTCCTGTCTTCTCGCCACGTTCCTCCCCTGCATGCTCTCCGGCCGAACGGCAACGAGAATG
CGAGATGCCTCGATGCAATCCTTCAGCGAGATCAACGACGAGTGCGTCATCTTCGGTCTCATCCATGGCTTCACC
GGCTTCGGATGGGTCCTCTCCATGATTCACCGCGGGGAGATCCGCCGCAGGTACGGCATCAAGGGGAACTGCTGT
GGCGATTACTGCGTTAGTTTCTGGTGTCTTTGCTGCGATCTCATTCAGCAGGATAAAGAGGTTCGTCGTCGGACG
GCTGGGCTTGTTACCGATGGCTATGATGGGAATAAGGAGCGCATGTATGTGCCTGGTGCTCCGGCTCCGGCGCAC
GGATATCCGCAGCAGCCGATGATGGTGTCGCAGCAGGATGAGGGCATGGTGTATGAGACGGGGCCGCAGCAGGAG
CAGCAGCAGCAGCCTCCGCCGTCCAAGGAGACGCGTGGGTGA
Transcript >Ophun1|3181
ATGGAAAACCCACCGCCCAACAACGGCCCTCTTCCACAGCCTCACGACGACAAATGGGGCAGTAATCTATGCAAC
TGCTCGCCCTGCGAGTCCTGTCTTCTCGCCACGTTCCTCCCCTGCATGCTCTCCGGCCGAACGGCAACGAGAATG
CGAGATGCCTCGATGCAATCCTTCAGCGAGATCAACGACGAGTGCGTCATCTTCGGTCTCATCCATGGCTTCACC
GGCTTCGGATGGGTCCTCTCCATGATTCACCGCGGGGAGATCCGCCGCAGGTACGGCATCAAGGGGAACTGCTGT
GGCGATTACTGCGTTAGTTTCTGGTGTCTTTGCTGCGATCTCATTCAGCAGGATAAAGAGGTTCGTCGTCGGACG
GCTGGGCTTGTTACCGATGGCTATGATGGGAATAAGGAGCGCATGTATGTGCCTGGTGCTCCGGCTCCGGCGCAC
GGATATCCGCAGCAGCCGATGATGGTGTCGCAGCAGGATGAGGGCATGGTGTATGAGACGGGGCCGCAGCAGGAG
CAGCAGCAGCAGCCTCCGCCGTCCAAGGAGACGCGTGGGTGA
Gene >Ophun1|3181
ATGGAAAACCCACCGCCCAACAACGGCCCTCTTCCACAGCCTCACGACGACAAATGGGGCAGTAATCTATGCAAC
TGCTCGCCCTGCGAGTCCTGTCTTCTCGCCACGTTCCTCCCCTGCATGCGTGAGAATCTCCAACCCCCCCCCCTT
TTCCACAACTCACACACGACTGACGAGGTGCGCCATCAGTCTCCGGCCGAACGGCAACGAGAATGCGAGATGCCT
CGATGCAATCCTTCAGCGAGATCAACGACGAGTGCGTCATCTTCGGTCTCATCCATGGCTTCACCGGCTTCGGAT
GGGTCCTCTCCATGATTCACCGCGGGGAGATCCGCCGCAGGTACGGCATCAAGGGGAACTGCTGTGGCGATTACT
GCGTTAGTTTCTGGTGTCTTTGCTGCGATCTCATTCAGCAGGATAAAGAGGTTCGTCGTCGGACGGCTGGGCTTG
TTACCGATGGCTATGATGGGAATAAGGAGCGCATGTATGTGCCTGGTGCTCCGGCTCCGGCGCACGGATATCCGC
AGCAGCCGATGATGGTGTCGCAGCAGGATGAGGGCATGGTGTATGAGACGGGGCCGCAGCAGGAGCAGCAGCAGC
AGCCTCCGCCGTCCAAGGAGACGCGTGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail