Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|318
Gene name
LocationContig_1088:367..3884
Strand+
Gene length (bp)3517
Transcript length (bp)2526
Coding sequence length (bp)2526
Protein length (aa) 842

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08631 SPO22 Meiosis protein SPO22/ZIP4 like 2.9E-51 480 753

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P19541|RDS2_YEAST Regulator of drug sensitivity 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDS2 PE=1 SV=2 98 315 1.0E-65
sp|B8PBQ6|ERT1_POSPM Transcription activator of gluconeogenesis ERT1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=ERT1 PE=3 SV=1 71 303 2.0E-22
sp|B0D0T8|ERT1_LACBS Transcription activator of gluconeogenesis ERT1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ERT1 PE=3 SV=1 135 303 6.0E-20
sp|Q4PD88|ERT1_USTMA Transcription activator of gluconeogenesis ERT1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERT1 PE=3 SV=2 124 315 2.0E-19
sp|A8N767|ERT1_COPC7 Transcription activator of gluconeogenesis ERT1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ERT1 PE=3 SV=1 135 303 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P19541|RDS2_YEAST Regulator of drug sensitivity 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDS2 PE=1 SV=2 98 315 1.0E-65
sp|B8PBQ6|ERT1_POSPM Transcription activator of gluconeogenesis ERT1 OS=Postia placenta (strain ATCC 44394 / Madison 698-R) GN=ERT1 PE=3 SV=1 71 303 2.0E-22
sp|B0D0T8|ERT1_LACBS Transcription activator of gluconeogenesis ERT1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=ERT1 PE=3 SV=1 135 303 6.0E-20
sp|Q4PD88|ERT1_USTMA Transcription activator of gluconeogenesis ERT1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERT1 PE=3 SV=2 124 315 2.0E-19
sp|A8N767|ERT1_COPC7 Transcription activator of gluconeogenesis ERT1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ERT1 PE=3 SV=1 135 303 3.0E-18
sp|C4QV17|GSM1_PICPG Glucose starvation modulator protein 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=GSM1 PE=3 SV=1 131 303 4.0E-18
sp|D8Q8R5|ERT1_SCHCM Transcription activator of gluconeogenesis ERT1 OS=Schizophyllum commune (strain H4-8 / FGSC 9210) GN=ERT1 PE=3 SV=1 138 303 5.0E-18
sp|C5E2K7|ERT1_LACTC Transcription activator of gluconeogenesis ERT1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=ERT1 PE=3 SV=1 137 315 8.0E-17
sp|C5E1J9|ERT1_ZYGRC Transcription activator of gluconeogenesis OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ERT1 PE=3 SV=1 90 303 1.0E-16
sp|Q6C764|ERT12_YARLI Transcription activator of gluconeogenesis ERT1-2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERT1-2 PE=3 SV=1 133 303 5.0E-16
sp|A6ZLH8|ERT1_YEAS7 Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain YJM789) GN=ERT1 PE=3 SV=1 138 303 3.0E-15
sp|P38140|ERT1_YEAST Transcription activator of gluconeogenesis ERT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERT1 PE=1 SV=1 138 303 3.0E-15
sp|C7GMR4|ERT1_YEAS2 Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain JAY291) GN=ERT1 PE=3 SV=1 138 303 3.0E-15
sp|D3UEY7|ERT1_YEAS8 Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=ERT1 PE=3 SV=1 138 303 3.0E-15
sp|B3LMS3|ERT1_YEAS1 Transcription activator of gluconeogenesis OS=Saccharomyces cerevisiae (strain RM11-1a) GN=ERT1 PE=3 SV=1 138 303 3.0E-15
sp|Q754V2|ERT1_ASHGO Transcription activator of gluconeogenesis ERT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERT1 PE=3 SV=2 137 267 4.0E-15
sp|B9WLA7|ERT1_CANDC Transcription activator of gluconeogenesis ERT1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERT1 PE=3 SV=1 137 284 1.0E-14
sp|C4YLC3|ERT1_CANAW Transcription activator of gluconeogenesis ERT1 OS=Candida albicans (strain WO-1) GN=ERT1 PE=3 SV=1 137 284 1.0E-14
sp|Q6C5G3|ERT11_YARLI Transcription activator of gluconeogenesis ERT1-1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERT1-1 PE=3 SV=1 133 315 3.0E-14
sp|Q6BY37|ERT1_DEBHA Transcription activator of gluconeogenesis ERT1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ERT1 PE=3 SV=2 133 283 4.0E-14
sp|A5DF43|ERT1_PICGU Transcription activator of gluconeogenesis ERT1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ERT1 PE=3 SV=2 133 315 5.0E-14
sp|Q6BJW8|GSM1_DEBHA Glucose starvation modulator protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GSM1 PE=3 SV=2 164 303 9.0E-14
sp|B9W8A8|GSM1_CANDC Glucose starvation modulator protein 1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GSM1 PE=3 SV=1 136 303 6.0E-13
sp|C4R1K8|ERT1_PICPG Transcription activator of gluconeogenesis ERT1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ERT1 PE=3 SV=1 133 315 1.0E-12
sp|C4Y4V1|GSM1_CLAL4 Glucose starvation modulator protein 1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=GSM1 PE=3 SV=1 139 303 1.0E-12
sp|A3LQV7|ERT1_PICST Transcription activator of gluconeogenesis ERT1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ERT1 PE=3 SV=2 133 303 1.0E-12
sp|Q6CKI5|ERT1_KLULA Transcription activator of gluconeogenesis ERT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERT1 PE=3 SV=1 139 315 1.0E-12
sp|A5DRJ2|GSM1_PICGU Glucose starvation modulator protein 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GSM1 PE=3 SV=2 139 283 2.0E-12
sp|C4YDV1|GSM1_CANAW Glucose starvation modulator protein 1 OS=Candida albicans (strain WO-1) GN=GSM1 PE=3 SV=1 136 303 2.0E-12
sp|Q59WB9|GSM1_CANAL Glucose starvation modulator protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ZCF23 PE=3 SV=1 136 303 2.0E-12
sp|C5MCK5|GSM1_CANTT Glucose starvation modulator protein 1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GSM1 PE=3 SV=1 164 303 4.0E-12
sp|Q6FML7|ERT1_CANGA Transcription activator of gluconeogenesis ERT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERT1 PE=3 SV=1 137 303 1.0E-10
sp|C5PHH6|ACUK_COCP7 Transcription activator of gluconeogenesis CPC735_053490 OS=Coccidioides posadasii (strain C735) GN=CPC735_053490 PE=3 SV=1 121 280 1.0E-10
sp|A3LWY2|GSM1_PICST Glucose starvation modulator protein 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=GSM1 PE=3 SV=2 139 321 2.0E-10
sp|B6Q3B6|ACUK_TALMQ Transcription activator of gluconeogenesis PMAA_028970 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=PMAA_028970 PE=3 SV=1 116 280 1.0E-09
sp|B8LT44|ACUK_TALSN Transcription activator of gluconeogenesis TSTA_069700 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=TSTA_069700 PE=3 SV=1 116 293 2.0E-09
sp|Q4WHD1|ACUK_ASPFU Transcription activator of gluconeogenesis acuK OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=acuK PE=3 SV=2 87 280 3.0E-09
sp|B0XVV1|ACUK_ASPFC Transcription activator of gluconeogenesis acuK OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=acuK PE=3 SV=2 87 280 4.0E-09
sp|A6SP81|ACUK_BOTFB Transcription activator of gluconeogenesis BC1G_14637 OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_14637 PE=3 SV=1 131 267 4.0E-09
sp|B6HSQ3|ACUK_PENRW Transcription activator of gluconeogenesis Pc22g08580 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=Pc22g08580 PE=3 SV=1 56 280 4.0E-09
sp|A1DG01|ACUK_NEOFI Transcription activator of gluconeogenesis acuK OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=acuK PE=3 SV=1 87 280 4.0E-09
sp|A5DU46|GSM1_LODEL Glucose starvation modulator protein 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GSM1 PE=3 SV=1 139 280 5.0E-09
sp|A2QFG8|ACUK_ASPNC Transcription activator of gluconeogenesis acuK OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=acuK PE=3 SV=1 122 280 7.0E-09
sp|P40511|SPO22_YEAST Sporulation-specific protein 22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO22 PE=3 SV=2 576 807 7.0E-09
sp|A6R213|ACUK_AJECN Transcription activator of gluconeogenesis HCAG_03671 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=HCAG_03671 PE=3 SV=1 121 280 1.0E-08
sp|C0NCM1|ACUK_AJECG Transcription activator of gluconeogenesis HCBG_00867 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_00867 PE=3 SV=1 121 280 2.0E-08
sp|A7EAG1|ACUK_SCLS1 Transcription activator of gluconeogenesis SS1G_02293 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=SS1G_02293 PE=3 SV=1 131 232 2.0E-08
sp|Q2GSA4|ACUK_CHAGB Transcription activator of gluconeogenesis CHGG_09150 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_09150 PE=3 SV=1 131 268 2.0E-08
sp|C7YM38|ACUK_NECH7 Transcription activator of gluconeogenesis NECHADRAFT_59099 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=NECHADRAFT_59099 PE=3 SV=1 137 315 8.0E-08
sp|B2AR36|ACUK_PODAN Transcription activator of gluconeogenesis PODANS_4_8760 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_4_8760 PE=3 SV=1 73 280 2.0E-07
sp|D1ZRZ5|ACUK_SORMK Transcription activator of gluconeogenesis SMAC_06113 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=SMAC_06113 PE=3 SV=2 131 232 4.0E-07
sp|Q7RUA4|ACUK_NEUCR Transcription activator of gluconeogenesis NCU03938 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=G17A4.270 PE=3 SV=2 131 232 4.0E-07
sp|B2W978|ACUK_PYRTR Transcription activator of gluconeogenesis PTRG_06536 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_06536 PE=3 SV=1 90 232 7.0E-07
sp|Q0U7C8|ACUK_PHANO Transcription activator of gluconeogenesis SNOG_12336 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_12336 PE=3 SV=2 94 232 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0051321 meiotic cell cycle Yes
GO:0009987 cellular process No
GO:0022414 reproductive process No
GO:0007049 cell cycle No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|318
MSNYNANYMIAPHVSHEFNLLDDFLQGGFLDMDALATDDGANTTAAAFGRSGNPPSLPAGFQPGGRPSVPAGLGA
GPSEMTPPGSGSNGKAPVRAAPSATDKTREYYLQAADPSGNDNAEERMARVLRAKYDAGLLKPFNYINGYARLGK
YLDGHIAPSSKQKILRTINQFRPKFREKAQGLTDMQLVYVEMWFERQLLDYDRVFASMAVPACCWRRTGEIFRGN
KEMAELIAVPVDQLRDGKIALHEILTEESMVRYWEEFGTIAFDPAHETLLTACSLKNPSDSSDHPIVKCCFSFSI
RRDEHKLTVRSIIDFAGDLEAKLSTTRDVAAVDVLVADLSQRLQTIQGLPLSTTHHGRAARDLERRGRSLWNACI
RAKREAGSLEGSRRRLLLSSRVLAFHMLELGRGDGGGKEEDVVYLLGRALTLARICVVDGELAEGRMALRKAAGF
VERLRSLGDDGLGGPVMRLEAEYLTMRMTLSWREDRLDVAEHMFGKTEMLRRHLDTPAAEVMADALRHIGADLSS
KGNHTLALQWLRRAHDLIDGQSPENLSTHGLELRLAICHGRVQSLLAVGSAESLQEANDIVAYVESELGDKPIVL
HWRLEILQKSPDDVLGVEARASILRRMVRCFDRSDDGLDFLLHQFTELSRCGGRLAVGLLDELIRRHLLTSANSV
WIGKGVVRRTWMATMAEGEDDVLESLRGFMDEAFDALSGPLKPDAAGAVHSLLWNKAEALFGGQQFATADGWCEV
GLHELLSSAGEANAGKFGRKRILCALKLNDADRAKQAYEQMSSSPQHDSLTSYLMFKVSLLSWDHELGCRSVARL
GAASGTIRGRDMLYAG*
Coding >Ophun1|318
ATGAGCAATTACAACGCCAACTATATGATAGCTCCTCACGTCTCTCACGAGTTCAATCTGCTCGACGACTTTCTA
CAGGGTGGTTTCCTCGATATGGACGCACTGGCGACTGACGACGGCGCCAACACCACGGCGGCGGCTTTCGGAAGG
TCGGGCAATCCCCCGAGCTTGCCGGCTGGTTTTCAACCCGGCGGAAGACCCTCCGTACCGGCCGGACTGGGAGCG
GGCCCGTCAGAGATGACGCCTCCGGGCAGCGGTTCCAATGGCAAGGCGCCGGTGAGGGCGGCCCCTTCGGCAACG
GATAAGACGCGTGAGTACTACTTGCAAGCGGCGGACCCGTCGGGCAACGACAACGCCGAAGAGCGAATGGCGCGT
GTCCTCCGTGCCAAGTACGACGCTGGTCTGCTCAAGCCCTTCAACTACATCAACGGCTACGCGCGGCTGGGAAAG
TACCTCGACGGGCACATTGCGCCGTCGTCGAAGCAGAAGATACTGCGGACCATCAACCAGTTCCGGCCCAAGTTT
CGCGAAAAGGCGCAGGGCCTGACGGATATGCAGCTCGTCTACGTCGAGATGTGGTTCGAGAGGCAGCTGCTCGAC
TACGATCGCGTGTTTGCCAGCATGGCGGTGCCGGCGTGCTGCTGGAGGAGGACGGGGGAGATTTTCAGGGGGAAT
AAGGAGATGGCTGAGCTGATTGCCGTGCCGGTTGATCAGCTGCGGGATGGCAAGATTGCGTTGCATGAGATTCTT
ACCGAGGAGTCCATGGTGCGATACTGGGAGGAATTCGGCACCATTGCCTTTGACCCGGCTCACGAGACGCTGTTG
ACGGCGTGCTCGTTGAAGAATCCGAGCGACTCGTCGGATCATCCGATTGTCAAGTGCTGCTTTTCGTTTTCTATC
CGGCGGGATGAGCACAAGCTGACGGTCCGCTCTATTATCGACTTTGCTGGCGATCTCGAGGCCAAGCTGTCGACG
ACGAGGGATGTCGCTGCGGTCGATGTCCTGGTGGCGGACCTTAGCCAGCGCCTCCAGACGATTCAGGGTCTTCCC
CTGTCGACGACGCACCACGGCCGAGCGGCACGGGACTTGGAGCGGCGCGGTCGGAGCCTCTGGAACGCCTGCATC
CGGGCCAAGAGGGAGGCTGGCTCGTTGGAGGGGAGCAGACGGAGGCTTCTGCTGTCGTCGCGCGTCTTGGCGTTT
CATATGCTTGAGCTGGGGAGGGGGGATGGGGGGGGGAAGGAGGAGGATGTCGTGTATCTTTTGGGGCGGGCGTTG
ACGCTGGCTCGGATTTGTGTGGTTGATGGGGAGTTGGCCGAGGGGAGGATGGCGTTGAGGAAGGCGGCTGGGTTT
GTTGAGAGGTTGAGGAGTCTGGGGGATGATGGGTTGGGAGGGCCGGTGATGAGGTTGGAGGCTGAGTATCTGACG
ATGCGGATGACGTTGTCGTGGAGAGAAGATCGACTTGACGTTGCCGAGCACATGTTTGGCAAGACGGAGATGCTT
CGTCGACATCTGGATACACCGGCAGCCGAGGTCATGGCAGATGCCCTGCGCCATATCGGTGCTGACCTGTCGTCC
AAGGGGAACCACACGCTGGCACTGCAGTGGCTGAGGAGGGCGCACGATCTCATCGACGGCCAGAGCCCGGAGAAT
CTGTCGACGCATGGGCTTGAGCTGCGGTTGGCTATATGTCATGGCCGCGTCCAGAGTCTGCTCGCCGTCGGGTCG
GCCGAGAGCCTCCAGGAGGCCAATGATATTGTGGCCTACGTCGAGTCTGAGCTCGGAGACAAGCCCATTGTGTTG
CACTGGCGTCTGGAGATTCTGCAAAAGTCGCCCGACGACGTCCTGGGCGTTGAGGCACGGGCCAGTATCCTGAGA
CGAATGGTGCGCTGCTTCGATCGGTCTGACGATGGGCTTGATTTTTTACTTCATCAGTTTACGGAGCTGAGTCGT
TGCGGTGGGAGGTTGGCGGTGGGACTGCTGGATGAGCTTATTAGACGGCATCTTTTGACGTCTGCTAACTCGGTC
TGGATTGGTAAGGGGGTGGTGAGGCGGACTTGGATGGCGACGATGGCGGAGGGTGAGGATGATGTGCTGGAGTCG
TTGAGGGGGTTTATGGACGAGGCGTTTGATGCTCTTTCGGGGCCGTTGAAGCCGGACGCGGCTGGGGCGGTGCAT
TCGCTTCTATGGAACAAGGCTGAGGCTCTGTTTGGCGGCCAGCAGTTTGCCACGGCCGATGGCTGGTGTGAGGTT
GGACTCCACGAGCTCCTTTCCAGCGCGGGCGAGGCCAATGCCGGCAAGTTCGGGAGGAAGCGCATCCTCTGCGCC
CTCAAGCTCAACGACGCGGACCGAGCCAAGCAGGCGTACGAGCAGATGTCCTCGAGCCCGCAACACGACAGCCTG
ACGAGCTACCTCATGTTCAAGGTCTCGCTGCTAAGCTGGGACCACGAGCTGGGATGCCGGAGCGTGGCCCGGCTC
GGGGCGGCGTCCGGGACGATACGGGGCCGCGATATGCTATACGCCGGCTGA
Transcript >Ophun1|318
ATGAGCAATTACAACGCCAACTATATGATAGCTCCTCACGTCTCTCACGAGTTCAATCTGCTCGACGACTTTCTA
CAGGGTGGTTTCCTCGATATGGACGCACTGGCGACTGACGACGGCGCCAACACCACGGCGGCGGCTTTCGGAAGG
TCGGGCAATCCCCCGAGCTTGCCGGCTGGTTTTCAACCCGGCGGAAGACCCTCCGTACCGGCCGGACTGGGAGCG
GGCCCGTCAGAGATGACGCCTCCGGGCAGCGGTTCCAATGGCAAGGCGCCGGTGAGGGCGGCCCCTTCGGCAACG
GATAAGACGCGTGAGTACTACTTGCAAGCGGCGGACCCGTCGGGCAACGACAACGCCGAAGAGCGAATGGCGCGT
GTCCTCCGTGCCAAGTACGACGCTGGTCTGCTCAAGCCCTTCAACTACATCAACGGCTACGCGCGGCTGGGAAAG
TACCTCGACGGGCACATTGCGCCGTCGTCGAAGCAGAAGATACTGCGGACCATCAACCAGTTCCGGCCCAAGTTT
CGCGAAAAGGCGCAGGGCCTGACGGATATGCAGCTCGTCTACGTCGAGATGTGGTTCGAGAGGCAGCTGCTCGAC
TACGATCGCGTGTTTGCCAGCATGGCGGTGCCGGCGTGCTGCTGGAGGAGGACGGGGGAGATTTTCAGGGGGAAT
AAGGAGATGGCTGAGCTGATTGCCGTGCCGGTTGATCAGCTGCGGGATGGCAAGATTGCGTTGCATGAGATTCTT
ACCGAGGAGTCCATGGTGCGATACTGGGAGGAATTCGGCACCATTGCCTTTGACCCGGCTCACGAGACGCTGTTG
ACGGCGTGCTCGTTGAAGAATCCGAGCGACTCGTCGGATCATCCGATTGTCAAGTGCTGCTTTTCGTTTTCTATC
CGGCGGGATGAGCACAAGCTGACGGTCCGCTCTATTATCGACTTTGCTGGCGATCTCGAGGCCAAGCTGTCGACG
ACGAGGGATGTCGCTGCGGTCGATGTCCTGGTGGCGGACCTTAGCCAGCGCCTCCAGACGATTCAGGGTCTTCCC
CTGTCGACGACGCACCACGGCCGAGCGGCACGGGACTTGGAGCGGCGCGGTCGGAGCCTCTGGAACGCCTGCATC
CGGGCCAAGAGGGAGGCTGGCTCGTTGGAGGGGAGCAGACGGAGGCTTCTGCTGTCGTCGCGCGTCTTGGCGTTT
CATATGCTTGAGCTGGGGAGGGGGGATGGGGGGGGGAAGGAGGAGGATGTCGTGTATCTTTTGGGGCGGGCGTTG
ACGCTGGCTCGGATTTGTGTGGTTGATGGGGAGTTGGCCGAGGGGAGGATGGCGTTGAGGAAGGCGGCTGGGTTT
GTTGAGAGGTTGAGGAGTCTGGGGGATGATGGGTTGGGAGGGCCGGTGATGAGGTTGGAGGCTGAGTATCTGACG
ATGCGGATGACGTTGTCGTGGAGAGAAGATCGACTTGACGTTGCCGAGCACATGTTTGGCAAGACGGAGATGCTT
CGTCGACATCTGGATACACCGGCAGCCGAGGTCATGGCAGATGCCCTGCGCCATATCGGTGCTGACCTGTCGTCC
AAGGGGAACCACACGCTGGCACTGCAGTGGCTGAGGAGGGCGCACGATCTCATCGACGGCCAGAGCCCGGAGAAT
CTGTCGACGCATGGGCTTGAGCTGCGGTTGGCTATATGTCATGGCCGCGTCCAGAGTCTGCTCGCCGTCGGGTCG
GCCGAGAGCCTCCAGGAGGCCAATGATATTGTGGCCTACGTCGAGTCTGAGCTCGGAGACAAGCCCATTGTGTTG
CACTGGCGTCTGGAGATTCTGCAAAAGTCGCCCGACGACGTCCTGGGCGTTGAGGCACGGGCCAGTATCCTGAGA
CGAATGGTGCGCTGCTTCGATCGGTCTGACGATGGGCTTGATTTTTTACTTCATCAGTTTACGGAGCTGAGTCGT
TGCGGTGGGAGGTTGGCGGTGGGACTGCTGGATGAGCTTATTAGACGGCATCTTTTGACGTCTGCTAACTCGGTC
TGGATTGGTAAGGGGGTGGTGAGGCGGACTTGGATGGCGACGATGGCGGAGGGTGAGGATGATGTGCTGGAGTCG
TTGAGGGGGTTTATGGACGAGGCGTTTGATGCTCTTTCGGGGCCGTTGAAGCCGGACGCGGCTGGGGCGGTGCAT
TCGCTTCTATGGAACAAGGCTGAGGCTCTGTTTGGCGGCCAGCAGTTTGCCACGGCCGATGGCTGGTGTGAGGTT
GGACTCCACGAGCTCCTTTCCAGCGCGGGCGAGGCCAATGCCGGCAAGTTCGGGAGGAAGCGCATCCTCTGCGCC
CTCAAGCTCAACGACGCGGACCGAGCCAAGCAGGCGTACGAGCAGATGTCCTCGAGCCCGCAACACGACAGCCTG
ACGAGCTACCTCATGTTCAAGGTCTCGCTGCTAAGCTGGGACCACGAGCTGGGATGCCGGAGCGTGGCCCGGCTC
GGGGCGGCGTCCGGGACGATACGGGGCCGCGATATGCTATACGCCGGCTGA
Gene >Ophun1|318
ATGAGCAATTACAACGCCAACTATATGATAGCTCCTCACGTCTCTCACGAGTTCAATCTGCTCGACGACTTTCTA
CAGGGTGGTTTCCTCGATATGGACGCACTGGCGACTGACGACGGCGCCAACACCACGGCGGCGGCTTTCGGAAGG
TCGGGCAATCCCCCGAGCTTGCCGGCTGGTTTTCAACCCGGCGGAAGACCCTCCGTACCGGCCGGACTGGGAGCG
GGCCCGTCAGAGATGACGCCTCCGGGCAGCGGTTCCAATGGCAAGGCGCCGGTGAGGGCGGCCCCTTCGGCAACG
GATAAGACGCGTGAGTACTACTTGCAAGCGGCGGACCCGTCGGGCAACGACAACGCCGAAGAGCGAATGGCGCGT
GTCCTCCGTGCCAAGTACGACGCTGGTCTGCTCAAGCCCTTCAACTACATCAACGGCTACGCGCGGCTGGGAAAG
TACCTCGACGGGCACATTGCGCCGTCGTCGAAGCAGAAGATACTGCGGACCATCAACCAGTTCCGGCCCAAGTTT
CGCGAAAAGGCGCAGGGCCTGACGGATATGCAGCTCGTCTACGTCGAGATGTGGTTCGAGAGGCAGCTGCTCGAC
TACGATCGCGTGTTTGCCAGCATGGCGGTGCCGGCGTGCTGCTGGAGGAGGACGGGGGAGATTTTCAGGGGGAAT
AAGGAGATGGCTGAGCTGATTGCCGTGCCGGTTGATCAGCTGCGGGATGTAAGTGGCCTTGTTCTTGTTACCTGG
TCCTGGAGTTTGGCTGATTGGGGTTTTCTCAGGGCAAGATTGCGTTGCATGAGATTCTTACCGAGGAGTCCATGG
TGCGATACTGGGAGGAATTCGGCACCATTGCCTTTGACCCGGCTCACGAGACGCTGTTGACGGCGTGCTCGTTGA
AGAATCCGAGCGACTCGTCGGATCATCCGATTGTCAAGTGCTGCTTTTCGTTTTCTATCCGGCGGGATGAGCACA
AGCTGTGAGTTGCTCCGTGTTCTCATTCGTGTGATGAGTATGCTAACGAGTTCAGGCCGGCTTTGATCGTTGGCA
ATTTCCTGCCGCATGATGTGCCGCCTCTTTGAGCGAAGGACGGAGAAGAGAAACAGAAGAAAAGGGGCCTCGGCC
GGGCGGAAAAGGATACCCGGGTTGTGGGCGATGGGCACATGGTCACCTGCGTCGTGTCTTGTCGGTGAGATGGAT
GCTGGAGCTGGAGCGGGAGTTGGGATGAATGAGATGGATGACATGTCCATTGCGCACACGGAGATGGAGGATGGT
GGATGACGTCAGTGAAGCTGGTGTTGTGATGTGGAAGGTACGGCTTGGCCACGGTGGTCGGAGCTGTATTTATTC
CGCTGCAGCCTTTTCCGGGTAGACGTCGAGAGGAGCATCAGGTAAAGGTGGTTATGTGCCAGCAGAATATCGCAC
GTTCGTTATGGCTTCTGTTGTGACTGCAGGCCGTGACAGGACGGTCCGCTCTATTATCGGTATGTGGTTCTATCA
CGCCTGTTCTACCGGGCTCTAAGGGATTGAAAGACTTTGCTGGCGATCTCGAGGCCAAGCTGTCGACGACGAGGG
ATGTCGCTGCGGTCGATGTCCTGGTGGCGGACCTTAGCCAGCGCCTCCAGACGATTCAGGGTCTTCCCCTGTCGA
CGACGCACCACGGCCGAGCGGCACGGGACTTGGAGCGGCGCGGTCGGAGCCTCTGGAACGCCTGCATCCGGGCCA
AGAGGGAGGCTGGCTCGTTGGAGGGGAGCAGACGGAGGCTTCTGCTGTCGTCGCGCGTCTTGGCGTTTCATATGC
TTGAGCTGGGGAGGGGGGATGGGGGGGGGAAGGAGGAGGATGTCGTGTATCTTTTGGGGCGGGCGTTGACGCTGG
CTCGGATTTGTGTGGTTGATGGGGAGTTGGCCGAGGGGAGGATGGCGTTGAGGAAGGCGGCTGGGTTTGTTGAGA
GGTTGAGGAGTCTGGGGGATGATGGGTTGGGAGGGCCGGTGATGAGGTTGGAGGCTGAGTATCTGACGATGCGGA
TGACGTTGGTGAGCGATCTGACTGTTGGGGTTCGGATAGAGGCTGACGAGAATGGGGTTTAGTCGTGGAGAGAAG
ATCGACTTGACGTTGCCGAGCACATGTTTGGCAAGACGGAGATGCTTCGTCGACATCTGGATACACCGGCAGCCG
AGGTCATGGCAGATGCCCTGCGCCATATCGGTGCTGACCTGTCGTCCAAGGGGAACCACACGCTGGCACTGCAGT
GGCTGAGGAGGGCGCACGATCTCATCGACGGCCAGAGCCCGGAGAATCTGTCGACGCATGGGCTTGAGCTGCGGT
TGGCTATATGTCATGGCCGCGTCCAGAGTCTGCTCGCCGTCGGGTCGGCCGAGAGCCTCCAGGAGGCCAATGATA
TTGTGGCCTACGTCGAGTCTGAGCTCGGAGACAAGCCCATTGTGTTGCACTGGCGTCTGGAGATTCTGCAAAAGT
CGCCCGACGACGTCCTGGGCGTTGAGGCACGGGCCAGTATCCTGAGACGAATGGTGCGCTGCTTCGATCGGTCTG
ACGATGGGCTTGATTTTTTACTTCATCAGTTTACGGAGCTGAGTCGTTGCGGTGGGAGGTTGGCGGTGGGACTGC
TGGATGAGCTTATTAGACGGCATCTTTTGACGTCTGCTAACTCGGTCTGGATTGGTAAGGGGGTGGTGAGGCGGA
CTTGGATGGCGACGATGGCGGAGGGTGAGGATGATGTGCTGGAGTCGTTGAGGGGGTTTATGGACGAGGCGTTTG
ATGCTCTTTCGGGGCCGTTGAAGCCGGACGCGGCTGGGGCGGTGCATTCGGTATGTTGTTCGAAAAGGGAGAGAG
GAAGTCGTTGACTGAGGTGATGAGGGGGCAGCTTCTATGGAACAAGGCTGAGGCTCTGTTTGGCGGCCAGCAGTT
TGCCACGGCCGATGGCTGGTGTGAGGTTGGACTCCACGAGCTCCTTTCCAGCGCGGGCGAGGCCAATGCCGGCAA
GTTCGGGAGGAAGCGCATCCTCTGCGCCCTCAAGCTCAACGACGCGGACCGAGCCAAGCAGGCGTACGAGCAGAT
GTCCTCGAGCCCGCAACACGACAGCCTGACGAGCTACCTCATGTTCAAGGTCTCGCTGCTAAGCTGGGACCACGA
GCTGGGATGCCGGAGCGTGGCCCGGCTCGGGGCGGCGTCCGGGACGATACGGGGCCGCGATATGCTATACGCGTG
CGTGCGGGAGGCGCAGCAGTTTGGCGATCGGGTTTGCGCGGTTGCTGCGTTGAGGGCTGTGGCGGAGGGGTGGGA
GGTTGGGCCGGTTGTTGCCGAGGGGTTGCCGGCTGTGTTGCGGTGTATGATCCGACTGATGTGCTTGAATGGGGA
GGAGGAGGCGGAGGAGAGGGAGGGGGGGGAGGGGAGGGATGAGTTTGCGGAGGAGATGTGTGCTGTTTTTGAGAA
GGGTATGTTGATTGCTGTTCTGTTTGCTGTTGTGATCTGCTGACGAGTTGGTTGGTGTAGCGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail