Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3175
Gene name
LocationContig_282:4840..8405
Strand-
Gene length (bp)3565
Transcript length (bp)3336
Coding sequence length (bp)3336
Protein length (aa) 1112

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00041 fn3 Fibronectin type III domain 4.6E-08 111 175

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1991
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|4379
Ophiocordyceps camponoti-floridani Ophcf2|02272
Ophiocordyceps camponoti-rufipedis Ophun1|3175 (this protein)
Ophiocordyceps kimflemingae Ophio5|5107
Ophiocordyceps subramaniannii Hirsu2|221

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3175
MLWALPTLTAACLALCSLYYFFSRHIASPRSVHAQVGLVGIALLIDCRRQALRLCEAAVHASIDAAPLQQLRMAL
ILGAVVWLLHRSWQTLWKPVPELVSILGVDIPQAPDVCLAGIGADSATLSWSRSASNRPVQKYLIQVNGVHVGES
PGNETAITVTGLRPNHFYNLRVVAVGPNNFRAGSPVIRLRTFGKDGRPQLGDSRLPTSFVDPDHSRCENVEEDDK
HERTVSSLPMVEAAPVLESSAVLPRDSAVVLSQRRNTVNRRHSPSVAGSDQPPARPSEPELSLTELTDKFEGIRR
EIEDTLALHTKEVTESHNQELELKRDVERKRLILREKEENTAQLKSEMRLTMETMRAAEKDRAKQEQQLKEKESK
KGAIRENIVKFEMDMERMKKERQSFENHKRELAKERDHDICKLDSENTALQNECNQLEADLRDKGKQLQDFKTAK
KQQSGVDDDRWREESSRLKRDWELHKRDLLNRLAAETKEGQLLSPQIRDLTDQLKVQQATGLAFYGQPGPSAADY
DPSPAPQPARAVHNGNPLLKAVLPSPDRVPLADSNLQAAVGFSSAGFMPRLFMDPAVDGINDIESKVSGETLSPS
AQTLLPSDIFEESEDADGMGSRSFFMLDHRPPKPAVEEGPQSPASSNMSFNVFSSPHGSAHNLTFPQYAENGEAK
SLNAGSSPSEAPTTSHKLASFLSTLQRGRAAKCSDGGGPPIGSLKPAQSQSFPSATDEDAMGSRRRINIGSWVVR
DSDTSERARPPSATPIGTSRPLSAMRPNPHKGSPAVAVSDREDELSRPASIASMDLPRPSTDSGSIWGAPGDSMA
LHKNRLWPRGEGPWPSRSGSRRPSLQGATAPTTTLASADDEILGEDELLNPETLPSQIGVIGSRPPAAVRTMSQR
LNPAAPTFMAHIFRKDKDKDKGKAKEVATSAGDLATGLDRSPSGSWRSRDGHSIHTQVSTSESRESLQLDSTVSN
AASDLQSPSASSLKDPDKAVRKLFRKGSSSKFSLSTRLGKDSSLFKKGSGSSANSDRNTPAEHRSSMGDADDVGD
DGAMLGRSFDSMASSSSLGPSKSKEGRETGRISSWRFSMSSIKKKGRDTPVKDAEQTPEDG*
Coding >Ophun1|3175
ATGTTATGGGCGCTTCCGACCCTGACCGCCGCTTGCCTCGCCCTCTGCAGCCTCTACTACTTCTTTAGCCGCCAT
ATAGCCAGCCCCAGGTCCGTCCACGCCCAAGTCGGCCTCGTCGGCATCGCTCTTCTCATCGACTGCCGCAGACAG
GCCCTGCGCCTGTGCGAGGCCGCCGTCCACGCCTCCATCGATGCCGCGCCTCTTCAGCAGTTGAGGATGGCCCTG
ATCCTCGGGGCTGTTGTCTGGCTCCTCCATCGTTCGTGGCAGACGCTCTGGAAACCAGTGCCAGAGCTGGTCAGC
ATCCTCGGAGTCGACATCCCCCAAGCCCCCGACGTCTGCCTGGCCGGCATCGGCGCCGACTCAGCTACGCTCAGC
TGGTCTCGGTCTGCGTCCAATCGGCCAGTGCAAAAGTATCTGATACAAGTAAACGGCGTTCACGTTGGAGAATCC
CCGGGCAATGAGACTGCCATTACCGTCACCGGCTTGCGTCCGAATCACTTCTACAATCTGCGCGTCGTCGCCGTT
GGTCCCAATAACTTTCGCGCCGGGAGTCCAGTCATCCGCCTTCGCACGTTTGGTAAAGATGGCAGACCGCAGCTG
GGCGACTCGCGCCTGCCCACCAGCTTCGTCGATCCCGATCACTCCCGCTGCGAGAATGTCGAAGAAGACGACAAA
CACGAAAGAACCGTCTCCTCGCTGCCCATGGTCGAGGCCGCTCCGGTTCTCGAAAGCAGCGCCGTCCTGCCCAGG
GACTCCGCAGTCGTCCTTAGCCAACGCCGAAATACCGTCAACCGTCGGCATTCGCCCTCCGTTGCTGGCTCAGAT
CAGCCCCCTGCAAGGCCATCGGAGCCCGAATTGTCTCTGACCGAGCTCACCGACAAGTTCGAGGGGATTAGGAGG
GAAATTGAGGACACGTTGGCTCTCCATACGAAGGAAGTGACCGAGTCTCATAACCAGGAGTTGGAGCTTAAGAGG
GATGTGGAACGCAAGCGACTGATTCTCAGAGAAAAGGAAGAAAATACGGCCCAACTCAAGAGCGAGATGCGCCTC
ACCATGGAGACGATGCGAGCCGCAGAAAAAGACCGGGCAAAACAGGAGCAGCAGCTCAAGGAAAAGGAGTCCAAA
AAGGGCGCGATTCGCGAAAACATTGTCAAGTTCGAAATGGACATGGAAAGAATGAAAAAGGAGCGCCAAAGCTTC
GAGAACCACAAGAGGGAGCTAGCCAAGGAGCGCGACCACGACATTTGCAAGCTCGACAGCGAAAACACGGCCTTG
CAGAACGAATGCAACCAGCTCGAGGCCGATCTTAGGGACAAGGGCAAGCAGCTGCAGGATTTTAAGACGGCCAAG
AAGCAGCAGTCGGGAGTCGATGACGACAGGTGGCGGGAAGAGAGCTCGAGGCTTAAGAGAGACTGGGAACTTCAT
AAGAGAGACCTGCTCAACCGCCTCGCTGCCGAGACGAAAGAGGGACAGCTCTTGAGCCCGCAGATTCGAGACCTC
ACGGACCAACTGAAAGTTCAGCAGGCGACAGGTCTCGCCTTTTACGGCCAGCCTGGTCCTTCAGCCGCCGACTAC
GATCCTTCGCCAGCTCCCCAGCCGGCGCGGGCGGTTCACAACGGCAATCCGCTACTCAAGGCCGTCCTGCCGTCG
CCTGACCGTGTTCCTCTGGCCGACTCCAATCTGCAGGCGGCCGTGGGCTTCAGTAGTGCTGGCTTCATGCCGCGA
CTATTCATGGACCCGGCAGTTGACGGCATCAATGACATCGAGTCTAAGGTCTCCGGTGAAACGCTGAGCCCTTCG
GCACAGACTCTCCTGCCCTCCGACATCTTTGAGGAGAGCGAAGATGCGGACGGCATGGGATCTAGGAGCTTCTTC
ATGCTAGACCACAGGCCTCCCAAACCCGCGGTTGAGGAGGGCCCGCAGTCTCCGGCCTCGTCCAACATGTCCTTC
AACGTCTTCTCGAGCCCGCATGGGTCTGCCCATAACCTCACTTTCCCGCAGTATGCTGAGAACGGCGAGGCAAAG
TCGCTCAACGCAGGATCCTCGCCGTCAGAGGCGCCGACCACCAGCCACAAGCTGGCCAGCTTCCTCTCGACCTTG
CAACGGGGCCGCGCGGCTAAGTGCTCCGACGGCGGCGGCCCGCCCATAGGAAGTCTCAAGCCCGCCCAGAGCCAG
TCTTTCCCTTCGGCGACTGACGAGGATGCCATGGGAAGCAGGCGAAGGATCAACATTGGCTCGTGGGTCGTTCGC
GATTCGGATACGTCAGAGAGGGCCAGGCCTCCCTCGGCAACACCCATCGGGACTTCGCGCCCGCTGTCGGCCATG
CGTCCCAATCCGCACAAGGGCTCGCCGGCCGTGGCCGTGTCCGACCGGGAGGACGAGCTTTCGCGGCCCGCGTCG
ATCGCGTCGATGGACCTGCCGCGTCCTTCTACCGACAGCGGGTCTATCTGGGGCGCTCCTGGAGACTCGATGGCG
CTACACAAGAACCGGCTCTGGCCTAGGGGAGAAGGCCCGTGGCCCTCTCGGAGCGGATCCAGGAGACCGTCTCTA
CAGGGCGCCACAGCGCCGACCACCACGCTCGCTTCTGCCGATGACGAGATTCTGGGCGAAGACGAGCTGCTCAAC
CCAGAGACGCTACCGAGCCAGATCGGTGTGATTGGATCTCGTCCGCCGGCCGCCGTGAGGACCATGAGTCAACGC
CTCAACCCAGCAGCCCCGACCTTTATGGCCCACATCTTTCGAAAGGACAAGGATAAGGACAAAGGCAAGGCAAAG
GAGGTGGCGACCTCGGCCGGTGACTTGGCGACCGGCTTGGACCGCTCACCCTCAGGGTCGTGGCGGTCTCGCGAC
GGGCATTCGATACACACGCAGGTTTCCACGTCCGAGTCTCGCGAATCGTTGCAGCTCGACTCGACCGTCTCCAAC
GCGGCTTCGGATTTGCAATCACCCTCGGCATCGAGCCTGAAGGACCCGGACAAGGCTGTTAGGAAGCTTTTCCGC
AAGGGCAGCTCGAGCAAGTTTAGTCTGTCGACGAGGCTGGGGAAGGACTCGAGCTTGTTTAAGAAGGGGTCTGGC
AGCAGCGCCAACTCGGACAGAAACACGCCGGCCGAACACCGCTCCAGCATGGGCGACGCCGACGACGTCGGAGAC
GATGGCGCCATGCTGGGACGAAGCTTTGATAGTATGGCGAGCAGCTCGTCCCTCGGCCCGTCCAAGTCCAAGGAA
GGTCGAGAAACAGGTAGGATTAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAGAAGGGCAGAGACACGCCG
GTCAAGGACGCGGAACAGACGCCGGAAGACGGCTAA
Transcript >Ophun1|3175
ATGTTATGGGCGCTTCCGACCCTGACCGCCGCTTGCCTCGCCCTCTGCAGCCTCTACTACTTCTTTAGCCGCCAT
ATAGCCAGCCCCAGGTCCGTCCACGCCCAAGTCGGCCTCGTCGGCATCGCTCTTCTCATCGACTGCCGCAGACAG
GCCCTGCGCCTGTGCGAGGCCGCCGTCCACGCCTCCATCGATGCCGCGCCTCTTCAGCAGTTGAGGATGGCCCTG
ATCCTCGGGGCTGTTGTCTGGCTCCTCCATCGTTCGTGGCAGACGCTCTGGAAACCAGTGCCAGAGCTGGTCAGC
ATCCTCGGAGTCGACATCCCCCAAGCCCCCGACGTCTGCCTGGCCGGCATCGGCGCCGACTCAGCTACGCTCAGC
TGGTCTCGGTCTGCGTCCAATCGGCCAGTGCAAAAGTATCTGATACAAGTAAACGGCGTTCACGTTGGAGAATCC
CCGGGCAATGAGACTGCCATTACCGTCACCGGCTTGCGTCCGAATCACTTCTACAATCTGCGCGTCGTCGCCGTT
GGTCCCAATAACTTTCGCGCCGGGAGTCCAGTCATCCGCCTTCGCACGTTTGGTAAAGATGGCAGACCGCAGCTG
GGCGACTCGCGCCTGCCCACCAGCTTCGTCGATCCCGATCACTCCCGCTGCGAGAATGTCGAAGAAGACGACAAA
CACGAAAGAACCGTCTCCTCGCTGCCCATGGTCGAGGCCGCTCCGGTTCTCGAAAGCAGCGCCGTCCTGCCCAGG
GACTCCGCAGTCGTCCTTAGCCAACGCCGAAATACCGTCAACCGTCGGCATTCGCCCTCCGTTGCTGGCTCAGAT
CAGCCCCCTGCAAGGCCATCGGAGCCCGAATTGTCTCTGACCGAGCTCACCGACAAGTTCGAGGGGATTAGGAGG
GAAATTGAGGACACGTTGGCTCTCCATACGAAGGAAGTGACCGAGTCTCATAACCAGGAGTTGGAGCTTAAGAGG
GATGTGGAACGCAAGCGACTGATTCTCAGAGAAAAGGAAGAAAATACGGCCCAACTCAAGAGCGAGATGCGCCTC
ACCATGGAGACGATGCGAGCCGCAGAAAAAGACCGGGCAAAACAGGAGCAGCAGCTCAAGGAAAAGGAGTCCAAA
AAGGGCGCGATTCGCGAAAACATTGTCAAGTTCGAAATGGACATGGAAAGAATGAAAAAGGAGCGCCAAAGCTTC
GAGAACCACAAGAGGGAGCTAGCCAAGGAGCGCGACCACGACATTTGCAAGCTCGACAGCGAAAACACGGCCTTG
CAGAACGAATGCAACCAGCTCGAGGCCGATCTTAGGGACAAGGGCAAGCAGCTGCAGGATTTTAAGACGGCCAAG
AAGCAGCAGTCGGGAGTCGATGACGACAGGTGGCGGGAAGAGAGCTCGAGGCTTAAGAGAGACTGGGAACTTCAT
AAGAGAGACCTGCTCAACCGCCTCGCTGCCGAGACGAAAGAGGGACAGCTCTTGAGCCCGCAGATTCGAGACCTC
ACGGACCAACTGAAAGTTCAGCAGGCGACAGGTCTCGCCTTTTACGGCCAGCCTGGTCCTTCAGCCGCCGACTAC
GATCCTTCGCCAGCTCCCCAGCCGGCGCGGGCGGTTCACAACGGCAATCCGCTACTCAAGGCCGTCCTGCCGTCG
CCTGACCGTGTTCCTCTGGCCGACTCCAATCTGCAGGCGGCCGTGGGCTTCAGTAGTGCTGGCTTCATGCCGCGA
CTATTCATGGACCCGGCAGTTGACGGCATCAATGACATCGAGTCTAAGGTCTCCGGTGAAACGCTGAGCCCTTCG
GCACAGACTCTCCTGCCCTCCGACATCTTTGAGGAGAGCGAAGATGCGGACGGCATGGGATCTAGGAGCTTCTTC
ATGCTAGACCACAGGCCTCCCAAACCCGCGGTTGAGGAGGGCCCGCAGTCTCCGGCCTCGTCCAACATGTCCTTC
AACGTCTTCTCGAGCCCGCATGGGTCTGCCCATAACCTCACTTTCCCGCAGTATGCTGAGAACGGCGAGGCAAAG
TCGCTCAACGCAGGATCCTCGCCGTCAGAGGCGCCGACCACCAGCCACAAGCTGGCCAGCTTCCTCTCGACCTTG
CAACGGGGCCGCGCGGCTAAGTGCTCCGACGGCGGCGGCCCGCCCATAGGAAGTCTCAAGCCCGCCCAGAGCCAG
TCTTTCCCTTCGGCGACTGACGAGGATGCCATGGGAAGCAGGCGAAGGATCAACATTGGCTCGTGGGTCGTTCGC
GATTCGGATACGTCAGAGAGGGCCAGGCCTCCCTCGGCAACACCCATCGGGACTTCGCGCCCGCTGTCGGCCATG
CGTCCCAATCCGCACAAGGGCTCGCCGGCCGTGGCCGTGTCCGACCGGGAGGACGAGCTTTCGCGGCCCGCGTCG
ATCGCGTCGATGGACCTGCCGCGTCCTTCTACCGACAGCGGGTCTATCTGGGGCGCTCCTGGAGACTCGATGGCG
CTACACAAGAACCGGCTCTGGCCTAGGGGAGAAGGCCCGTGGCCCTCTCGGAGCGGATCCAGGAGACCGTCTCTA
CAGGGCGCCACAGCGCCGACCACCACGCTCGCTTCTGCCGATGACGAGATTCTGGGCGAAGACGAGCTGCTCAAC
CCAGAGACGCTACCGAGCCAGATCGGTGTGATTGGATCTCGTCCGCCGGCCGCCGTGAGGACCATGAGTCAACGC
CTCAACCCAGCAGCCCCGACCTTTATGGCCCACATCTTTCGAAAGGACAAGGATAAGGACAAAGGCAAGGCAAAG
GAGGTGGCGACCTCGGCCGGTGACTTGGCGACCGGCTTGGACCGCTCACCCTCAGGGTCGTGGCGGTCTCGCGAC
GGGCATTCGATACACACGCAGGTTTCCACGTCCGAGTCTCGCGAATCGTTGCAGCTCGACTCGACCGTCTCCAAC
GCGGCTTCGGATTTGCAATCACCCTCGGCATCGAGCCTGAAGGACCCGGACAAGGCTGTTAGGAAGCTTTTCCGC
AAGGGCAGCTCGAGCAAGTTTAGTCTGTCGACGAGGCTGGGGAAGGACTCGAGCTTGTTTAAGAAGGGGTCTGGC
AGCAGCGCCAACTCGGACAGAAACACGCCGGCCGAACACCGCTCCAGCATGGGCGACGCCGACGACGTCGGAGAC
GATGGCGCCATGCTGGGACGAAGCTTTGATAGTATGGCGAGCAGCTCGTCCCTCGGCCCGTCCAAGTCCAAGGAA
GGTCGAGAAACAGGTAGGATTAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAGAAGGGCAGAGACACGCCG
GTCAAGGACGCGGAACAGACGCCGGAAGACGGCTAA
Gene >Ophun1|3175
ATGTTATGGGCGCTTCCGACCCTGACCGCCGCTTGCCTCGCCCTCTGCAGCCTCTACTACTTCTTTAGCCGCCAT
ATAGCCAGCCCCAGGTCCGTCCACGCCCAAGTCGGCCTCGTCGGCATCGCTCTTCTCATCGACTGCCGCAGACAG
GCCCTGCGCCTGTGCGAGGCCGCCGTCCACGCCTCCATCGATGCCGCGCCTCTTCAGCAGTTGAGGATGGCCCTG
ATCCTCGGGGCTGTTGTCTGGTGAGTTGCCCTGTCCGCTCCTCCGTTTCGTGTTGGCAGCATCGACTTTTTTTTT
CCGCACGCCCAAGGGAGAATTTCGCGCTTCTTCCCTGCCTGCGACGCAAACAAACGCTTCTATTGTCCCGATGAC
GCCAATATCTCTGACGCCAGTACTTTGACAGGCTCCTCCATCGTTCGTGGCAGACGCTCTGGAAACCAGTGCCAG
AGCTGGTCAGCATCCTCGGAGTCGACATCCCCCAAGCCCCCGACGTCTGCCTGGCCGGCATCGGCGCCGACTCAG
CTACGCTCAGCTGGTCTCGGTCTGCGTCCAATCGGCCAGTGCAAAAGTATCTGATACAAGTAAACGGCGTTCACG
GTCAGTCCCCCCCACCACTAGAAGGCGCCTGATCCTGTTGCTCAAGGCTAACCCGCCTATTCTCACAGTTGGAGA
ATCCCCGGGCAATGAGACTGCCATTACCGTCACCGGCTTGCGTCCGAATCACTTCTACAATCTGCGCGTCGTCGC
CGTTGGTCCCAATAACTTTCGCGCCGGGAGTCCAGTCATCCGCCTTCGCACGTTTGGTAAAGATGGCAGACCGCA
GCTGGGCGACTCGCGCCTGCCCACCAGCTTCGTCGATCCCGATCACTCCCGCTGCGAGAATGTCGAAGAAGACGA
CAAACACGAAAGAACCGTCTCCTCGCTGCCCATGGTCGAGGCCGCTCCGGTTCTCGAAAGCAGCGCCGTCCTGCC
CAGGGACTCCGCAGTCGTCCTTAGCCAACGCCGAAATACCGTCAACCGTCGGCATTCGCCCTCCGTTGCTGGCTC
AGATCAGCCCCCTGCAAGGCCATCGGAGCCCGAATTGTCTCTGACCGAGCTCACCGACAAGTTCGAGGGGATTAG
GAGGGAAATTGAGGACACGTTGGCTCTCCATACGAAGGAAGTGACCGAGTCTCATAACCAGGAGTTGGAGCTTAA
GAGGGATGTGGAACGCAAGCGACTGATTCTCAGAGAAAAGGAAGAAAATACGGCCCAACTCAAGAGCGAGATGCG
CCTCACCATGGAGACGATGCGAGCCGCAGAAAAAGACCGGGCAAAACAGGAGCAGCAGCTCAAGGAAAAGGAGTC
CAAAAAGGGCGCGATTCGCGAAAACATTGTCAAGTTCGAAATGGACATGGAAAGAATGAAAAAGGAGCGCCAAAG
CTTCGAGAACCACAAGAGGGAGCTAGCCAAGGAGCGCGACCACGACATTTGCAAGCTCGACAGCGAAAACACGGC
CTTGCAGAACGAATGCAACCAGCTCGAGGCCGATCTTAGGGACAAGGGCAAGCAGCTGCAGGATTTTAAGACGGC
CAAGAAGCAGCAGTCGGGAGTCGATGACGACAGGTGGCGGGAAGAGAGCTCGAGGCTTAAGAGAGACTGGGAACT
TCATAAGAGAGACCTGCTCAACCGCCTCGCTGCCGAGACGAAAGAGGGACAGCTCTTGAGCCCGCAGATTCGAGA
CCTCACGGACCAACTGAAAGTTCAGCAGGCGACAGGTCTCGCCTTTTACGGCCAGCCTGGTCCTTCAGCCGCCGA
CTACGATCCTTCGCCAGCTCCCCAGCCGGCGCGGGCGGTTCACAACGGCAATCCGCTACTCAAGGCCGTCCTGCC
GTCGCCTGACCGTGTTCCTCTGGCCGACTCCAATCTGCAGGCGGCCGTGGGCTTCAGTAGTGCTGGCTTCATGCC
GCGACTATTCATGGACCCGGCAGTTGACGGCATCAATGACATCGAGTCTAAGGTCTCCGGTGAAACGCTGAGCCC
TTCGGCACAGACTCTCCTGCCCTCCGACATCTTTGAGGAGAGCGAAGATGCGGACGGCATGGGATCTAGGAGCTT
CTTCATGCTAGACCACAGGCCTCCCAAACCCGCGGTTGAGGAGGGCCCGCAGTCTCCGGCCTCGTCCAACATGTC
CTTCAACGTCTTCTCGAGCCCGCATGGGTCTGCCCATAACCTCACTTTCCCGCAGTATGCTGAGAACGGCGAGGC
AAAGTCGCTCAACGCAGGATCCTCGCCGTCAGAGGCGCCGACCACCAGCCACAAGCTGGCCAGCTTCCTCTCGAC
CTTGCAACGGGGCCGCGCGGCTAAGTGCTCCGACGGCGGCGGCCCGCCCATAGGAAGTCTCAAGCCCGCCCAGAG
CCAGTCTTTCCCTTCGGCGACTGACGAGGATGCCATGGGAAGCAGGCGAAGGATCAACATTGGCTCGTGGGTCGT
TCGCGATTCGGATACGTCAGAGAGGGCCAGGCCTCCCTCGGCAACACCCATCGGGACTTCGCGCCCGCTGTCGGC
CATGCGTCCCAATCCGCACAAGGGCTCGCCGGCCGTGGCCGTGTCCGACCGGGAGGACGAGCTTTCGCGGCCCGC
GTCGATCGCGTCGATGGACCTGCCGCGTCCTTCTACCGACAGCGGGTCTATCTGGGGCGCTCCTGGAGACTCGAT
GGCGCTACACAAGAACCGGCTCTGGCCTAGGGGAGAAGGCCCGTGGCCCTCTCGGAGCGGATCCAGGAGACCGTC
TCTACAGGGCGCCACAGCGCCGACCACCACGCTCGCTTCTGCCGATGACGAGATTCTGGGCGAAGACGAGCTGCT
CAACCCAGAGACGCTACCGAGCCAGATCGGTGTGATTGGATCTCGTCCGCCGGCCGCCGTGAGGACCATGAGTCA
ACGCCTCAACCCAGCAGCCCCGACCTTTATGGCCCACATCTTTCGAAAGGACAAGGATAAGGACAAAGGCAAGGC
AAAGGAGGTGGCGACCTCGGCCGGTGACTTGGCGACCGGCTTGGACCGCTCACCCTCAGGGTCGTGGCGGTCTCG
CGACGGGCATTCGATACACACGCAGGTTTCCACGTCCGAGTCTCGCGAATCGTTGCAGCTCGACTCGACCGTCTC
CAACGCGGCTTCGGATTTGCAATCACCCTCGGCATCGAGCCTGAAGGACCCGGACAAGGCTGTTAGGAAGCTTTT
CCGCAAGGGCAGCTCGAGCAAGTTTAGTCTGTCGACGAGGCTGGGGAAGGACTCGAGCTTGTTTAAGAAGGGGTC
TGGCAGCAGCGCCAACTCGGACAGAAACACGCCGGCCGAACACCGCTCCAGCATGGGCGACGCCGACGACGTCGG
AGACGATGGCGCCATGCTGGGACGAAGCTTTGATAGTATGGCGAGCAGCTCGTCCCTCGGCCCGTCCAAGTCCAA
GGAAGGTCGAGAAACAGGTAGGATTAGCAGCTGGCGCTTCTCCATGTCGTCAATTAAGAAGAAGGGCAGAGACAC
GCCGGTCAAGGACGCGGAACAGACGCCGGAAGACGGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail