Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3174
Gene name
LocationContig_282:74..4479
Strand-
Gene length (bp)4405
Transcript length (bp)3573
Coding sequence length (bp)3573
Protein length (aa) 1191

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04100 Vps53_N Vps53-like, N-terminal 6.5E-103 57 433
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.3E-36 907 1185
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 1.7E-13 967 1187
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.2E-11 1059 1132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P51978|TRXB_NEUCR Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 904 1187 7.0E-147
sp|P43496|TRXB_PENCH Thioredoxin reductase OS=Penicillium chrysogenum GN=TRR1 PE=1 SV=3 904 1189 1.0E-136
sp|Q6C7L4|TRXB_YARLI Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 905 1187 8.0E-125
sp|Q5ZLD7|VPS53_CHICK Vacuolar protein sorting-associated protein 53 homolog OS=Gallus gallus GN=VPS53 PE=2 SV=1 52 744 2.0E-118
sp|Q8J0U0|TRXB_PNEJI Thioredoxin reductase OS=Pneumocystis jiroveci GN=TRR1 PE=2 SV=1 904 1187 4.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P51978|TRXB_NEUCR Thioredoxin reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cys-9 PE=3 SV=1 904 1187 7.0E-147
sp|P43496|TRXB_PENCH Thioredoxin reductase OS=Penicillium chrysogenum GN=TRR1 PE=1 SV=3 904 1189 1.0E-136
sp|Q6C7L4|TRXB_YARLI Thioredoxin reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TRR1 PE=3 SV=1 905 1187 8.0E-125
sp|Q5ZLD7|VPS53_CHICK Vacuolar protein sorting-associated protein 53 homolog OS=Gallus gallus GN=VPS53 PE=2 SV=1 52 744 2.0E-118
sp|Q8J0U0|TRXB_PNEJI Thioredoxin reductase OS=Pneumocystis jiroveci GN=TRR1 PE=2 SV=1 904 1187 4.0E-114
sp|Q7Z7S3|TRXB_PNECA Thioredoxin reductase OS=Pneumocystis carinii GN=TRR1 PE=2 SV=1 904 1187 5.0E-114
sp|P29509|TRXB1_YEAST Thioredoxin reductase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR1 PE=1 SV=3 904 1187 2.0E-113
sp|Q6BIS1|TRXB_DEBHA Thioredoxin reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TRR1 PE=3 SV=1 904 1187 2.0E-112
sp|Q92375|TRXB_SCHPO Thioredoxin reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trr1 PE=1 SV=1 905 1187 3.0E-112
sp|Q6HA24|TRXB_KLULA Thioredoxin reductase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TRR1 PE=3 SV=1 904 1187 1.0E-111
sp|P38816|TRXB2_YEAST Thioredoxin reductase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRR2 PE=1 SV=1 894 1187 1.0E-111
sp|Q6FR39|TRXB_CANGA Thioredoxin reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TRR1 PE=3 SV=1 905 1187 2.0E-111
sp|Q75CM8|TRXB_ASHGO Thioredoxin reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TRR1 PE=3 SV=2 904 1187 8.0E-111
sp|P87129|VPS53_SCHPO Vacuolar protein sorting-associated protein 53 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps53 PE=1 SV=1 111 745 2.0E-110
sp|Q8CCB4|VPS53_MOUSE Vacuolar protein sorting-associated protein 53 homolog OS=Mus musculus GN=Vps53 PE=1 SV=1 52 744 2.0E-109
sp|Q39242|TRXB2_ARATH Thioredoxin reductase 2 OS=Arabidopsis thaliana GN=NTR2 PE=2 SV=2 906 1187 1.0E-100
sp|Q5R5J4|VPS53_PONAB Vacuolar protein sorting-associated protein 53 homolog OS=Pongo abelii GN=VPS53 PE=2 SV=1 52 650 9.0E-99
sp|Q5VIR6|VPS53_HUMAN Vacuolar protein sorting-associated protein 53 homolog OS=Homo sapiens GN=VPS53 PE=1 SV=1 52 650 1.0E-98
sp|Q54UU8|TRXB_DICDI Thioredoxin reductase OS=Dictyostelium discoideum GN=trrA PE=3 SV=1 907 1189 2.0E-98
sp|Q39243|TRXB1_ARATH Thioredoxin reductase 1 OS=Arabidopsis thaliana GN=NTR1 PE=1 SV=3 905 1187 1.0E-95
sp|Q6ZFU6|NTRB_ORYSJ Thioredoxin reductase NTRB OS=Oryza sativa subsp. japonica GN=NTRB PE=2 SV=1 896 1187 4.0E-95
sp|O84101|TRXB_CHLTR Thioredoxin reductase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxB PE=3 SV=2 905 1187 7.0E-92
sp|Q9PKT7|TRXB_CHLMU Thioredoxin reductase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxB PE=3 SV=1 905 1187 3.0E-90
sp|Q69PS6|NTRA_ORYSJ Thioredoxin reductase NTRA OS=Oryza sativa subsp. japonica GN=Os06g0327300 PE=3 SV=2 895 1187 4.0E-90
sp|Q9Z8M4|TRXB_CHLPN Thioredoxin reductase OS=Chlamydia pneumoniae GN=trxB PE=3 SV=1 904 1187 5.0E-88
sp|Q0WQF4|VP53A_ARATH Vacuolar protein sorting-associated protein 53 A OS=Arabidopsis thaliana GN=VPS53 PE=1 SV=1 60 747 6.0E-84
sp|Q70G58|NTRC_ORYSJ Thioredoxin reductase NTRC OS=Oryza sativa subsp. japonica GN=Os07g0657900 PE=1 SV=2 908 1187 7.0E-84
sp|O22229|TRXB3_ARATH NADPH-dependent thioredoxin reductase 3 OS=Arabidopsis thaliana GN=NTRC PE=1 SV=2 908 1187 4.0E-82
sp|Q1RJD8|TRXB_RICBR Thioredoxin reductase OS=Rickettsia bellii (strain RML369-C) GN=trxB PE=3 SV=1 903 1187 1.0E-72
sp|O30973|TRXB_MYCSM Thioredoxin reductase OS=Mycobacterium smegmatis GN=trxB PE=3 SV=1 908 1187 4.0E-72
sp|P34561|VPS53_CAEEL Vacuolar protein sorting-associated protein 53 homolog OS=Caenorhabditis elegans GN=vps-53 PE=1 SV=4 61 744 7.0E-71
sp|Q05741|TRXB_STRC2 Thioredoxin reductase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=trxB PE=1 SV=3 907 1187 3.0E-70
sp|Q68WT3|TRXB_RICTY Thioredoxin reductase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=trxB PE=3 SV=1 903 1187 1.0E-69
sp|Q9ZD97|TRXB_RICPR Thioredoxin reductase OS=Rickettsia prowazekii (strain Madrid E) GN=trxB PE=3 SV=1 903 1187 2.0E-69
sp|Q4ULP1|TRXB_RICFE Thioredoxin reductase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxB PE=3 SV=1 903 1187 5.0E-69
sp|P52215|TRXB_STRCO Thioredoxin reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxB PE=2 SV=3 907 1187 7.0E-69
sp|Q92I02|TRXB_RICCN Thioredoxin reductase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=trxB PE=3 SV=1 903 1187 1.0E-67
sp|P9WHH1|TRXB_MYCTU Thioredoxin reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxB PE=1 SV=1 908 1187 1.0E-64
sp|P9WHH0|TRXB_MYCTO Thioredoxin reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxB PE=3 SV=1 908 1187 1.0E-64
sp|Q93HX6|GLCAL_PSEFL Glucosaminate ammonia-lyase OS=Pseudomonas fluorescens PE=1 SV=2 905 1187 9.0E-63
sp|Q9KSS4|TRXB_VIBCH Thioredoxin reductase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=trxB PE=3 SV=1 905 1187 3.0E-61
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 907 1187 6.0E-61
sp|P43788|TRXB_HAEIN Thioredoxin reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxB PE=3 SV=1 905 1187 2.0E-60
sp|P39916|TRXB_COXBU Thioredoxin reductase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=trxB PE=3 SV=2 905 1184 1.0E-59
sp|P0A9P4|TRXB_ECOLI Thioredoxin reductase OS=Escherichia coli (strain K12) GN=trxB PE=1 SV=2 902 1187 2.0E-57
sp|P0A9P5|TRXB_ECO57 Thioredoxin reductase OS=Escherichia coli O157:H7 GN=trxB PE=3 SV=2 902 1187 2.0E-57
sp|Q8T6Z1|TRXB_SPIBA Thioredoxin reductase (Fragment) OS=Spironucleus barkhanus GN=TRXB PE=2 SV=1 908 1187 2.0E-57
sp|P47061|VPS53_YEAST Vacuolar protein sorting-associated protein 53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS53 PE=1 SV=1 55 703 1.0E-53
sp|P81433|TRXB_BUCAP Thioredoxin reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxB PE=3 SV=1 905 1187 1.0E-50
sp|O32823|TRXB_LISMO Thioredoxin reductase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=trxB PE=3 SV=1 908 1174 2.0E-50
sp|Q928B5|TRXB_LISIN Thioredoxin reductase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=trxB PE=3 SV=1 908 1174 4.0E-49
sp|P94284|TRXB_BORBU Thioredoxin reductase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=trxB PE=3 SV=2 898 1189 8.0E-49
sp|P57399|TRXB_BUCAI Thioredoxin reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxB PE=3 SV=1 905 1175 1.0E-47
sp|P66011|TRXB_STAAW Thioredoxin reductase OS=Staphylococcus aureus (strain MW2) GN=trxB PE=1 SV=1 902 1187 3.0E-47
sp|Q6GB66|TRXB_STAAS Thioredoxin reductase OS=Staphylococcus aureus (strain MSSA476) GN=trxB PE=3 SV=1 902 1187 3.0E-47
sp|P99101|TRXB_STAAN Thioredoxin reductase OS=Staphylococcus aureus (strain N315) GN=trxB PE=1 SV=1 902 1187 3.0E-47
sp|P66010|TRXB_STAAM Thioredoxin reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=trxB PE=3 SV=1 902 1187 3.0E-47
sp|Q5HHQ4|TRXB_STAAC Thioredoxin reductase OS=Staphylococcus aureus (strain COL) GN=trxB PE=3 SV=1 902 1187 3.0E-47
sp|Q89AJ2|TRXB_BUCBP Thioredoxin reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxB PE=3 SV=1 905 1187 6.0E-47
sp|Q6GIM7|TRXB_STAAR Thioredoxin reductase OS=Staphylococcus aureus (strain MRSA252) GN=trxB PE=3 SV=1 902 1187 2.0E-46
sp|Q8CPY8|TRXB_STAES Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=trxB PE=3 SV=1 902 1187 3.0E-46
sp|Q5HQW4|TRXB_STAEQ Thioredoxin reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=trxB PE=3 SV=1 902 1187 3.0E-46
sp|P80880|TRXB_BACSU Thioredoxin reductase OS=Bacillus subtilis (strain 168) GN=trxB PE=1 SV=3 908 1174 2.0E-44
sp|P52213|TRXB_CLOLI Thioredoxin reductase OS=Clostridium litorale GN=trxB PE=3 SV=1 908 1187 3.0E-44
sp|P50971|TRXB_EUBAC Thioredoxin reductase OS=Eubacterium acidaminophilum GN=trxB PE=1 SV=1 908 1187 2.0E-43
sp|P23160|R34K_CLOPA 34.2 kDa protein in rubredoxin operon OS=Clostridium pasteurianum PE=3 SV=1 908 1187 4.0E-41
sp|O83790|TRXB_TREPA Thioredoxin reductase OS=Treponema pallidum (strain Nichols) GN=trxB PE=3 SV=1 908 1187 2.0E-38
sp|F4I7Y2|VP53B_ARATH Vacuolar protein sorting-associated protein 53 B OS=Arabidopsis thaliana GN=At1g50970 PE=2 SV=1 61 430 2.0E-37
sp|P56431|TRXB_HELPY Thioredoxin reductase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxB PE=1 SV=1 910 1174 3.0E-35
sp|Q9ZL18|TRXB_HELPJ Thioredoxin reductase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxB PE=3 SV=1 910 1174 1.0E-34
sp|Q58931|TRXB_METJA Putative thioredoxin reductase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1536 PE=3 SV=1 904 1187 1.0E-33
sp|O66790|TRXB_AQUAE Thioredoxin reductase OS=Aquifex aeolicus (strain VF5) GN=trxB PE=3 SV=1 899 1187 2.0E-30
sp|Q98PK9|TRXB_MYCPU Thioredoxin reductase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=trxB PE=3 SV=1 908 1187 2.0E-29
sp|Q8CMQ1|AHPF_STAES Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ahpF PE=3 SV=1 908 1187 2.0E-28
sp|Q6GJR8|AHPF_STAAR Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MRSA252) GN=ahpF PE=3 SV=1 908 1187 2.0E-28
sp|Q5HRY2|AHPF_STAEQ Alkyl hydroperoxide reductase subunit F OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ahpF PE=3 SV=1 908 1187 2.0E-28
sp|Q6GC92|AHPF_STAAS Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MSSA476) GN=ahpF PE=3 SV=1 908 1187 2.0E-28
sp|P66013|AHPF_STAAW Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain MW2) GN=ahpF PE=3 SV=1 908 1187 2.0E-28
sp|P99118|AHPF_STAAN Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain N315) GN=ahpF PE=1 SV=1 908 1187 2.0E-28
sp|P66012|AHPF_STAAM Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ahpF PE=3 SV=1 908 1187 2.0E-28
sp|Q5HIR6|AHPF_STAAC Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain COL) GN=ahpF PE=3 SV=1 908 1187 1.0E-27
sp|O05204|AHPF_STAA8 Alkyl hydroperoxide reductase subunit F OS=Staphylococcus aureus (strain NCTC 8325) GN=ahpF PE=3 SV=1 908 1187 1.0E-27
sp|P35340|AHPF_ECOLI Alkyl hydroperoxide reductase subunit F OS=Escherichia coli (strain K12) GN=ahpF PE=1 SV=2 908 1187 6.0E-25
sp|P19480|AHPF_SALTY Alkyl hydroperoxide reductase subunit F OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ahpF PE=1 SV=1 908 1187 1.0E-24
sp|P47348|TRXB_MYCGE Thioredoxin reductase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxB PE=3 SV=1 908 1187 2.0E-22
sp|Q9PR71|TRXB_UREPA Thioredoxin reductase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=trxB PE=3 SV=1 908 1187 2.0E-22
sp|P26829|DHNA_BACYN NADH dehydrogenase OS=Bacillus sp. (strain YN-1) GN=ahpF PE=1 SV=1 908 1187 4.0E-22
sp|P42974|DHNA_BACSU NADH dehydrogenase OS=Bacillus subtilis (strain 168) GN=ahpF PE=1 SV=2 908 1187 3.0E-21
sp|P75531|TRXB_MYCPN Thioredoxin reductase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxB PE=3 SV=1 923 1187 6.0E-20
sp|Q9I6Z2|AHPF_PSEAE Alkyl hydroperoxide reductase subunit F OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ahpF PE=3 SV=1 940 1187 2.0E-19
sp|P0A156|AHPF_PSEPU Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida GN=ahpF PE=3 SV=1 1013 1187 6.0E-18
sp|P0A155|AHPF_PSEPK Alkyl hydroperoxide reductase subunit F OS=Pseudomonas putida (strain KT2440) GN=ahpF PE=3 SV=1 1013 1187 6.0E-18
sp|O06465|AHPF_XANCH Alkyl hydroperoxide reductase subunit F OS=Xanthomonas campestris pv. phaseoli GN=ahpF PE=3 SV=1 1016 1187 1.0E-16
sp|Q9K7F3|FENR_BACHD Ferredoxin--NADP reductase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH3408 PE=3 SV=1 908 1187 3.0E-12
sp|Q4JCM0|FENR1_SULAC Ferredoxin--NADP reductase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0029 PE=3 SV=1 908 1187 4.0E-12
sp|Q6L1Y6|FENR_PICTO Ferredoxin--NADP reductase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=PTO0431 PE=3 SV=1 908 1187 5.0E-12
sp|Q72LG3|FENR_THET2 Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0096 PE=3 SV=1 905 1189 6.0E-12
sp|A4YER6|FENR_METS5 Ferredoxin--NADP reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_0743 PE=3 SV=2 907 1187 1.0E-11
sp|Q96YN9|FENR_SULTO Ferredoxin--NADP reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_21330 PE=3 SV=2 908 1152 1.0E-11
sp|Q5SL28|FENR_THET8 Ferredoxin--NADP reductase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0465 PE=1 SV=1 905 1189 2.0E-11
sp|A0AL74|FENR2_LISW6 Ferredoxin--NADP reductase 2 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lwe2338 PE=3 SV=1 900 1187 4.0E-11
sp|B2GEF7|FENR_LACF3 Ferredoxin--NADP reductase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_1703 PE=3 SV=1 908 1107 8.0E-11
sp|Q8ENX4|FENR2_OCEIH Ferredoxin--NADP reductase 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB2351 PE=3 SV=1 908 1120 2.0E-10
sp|Q97WJ5|FENR_SULSO Ferredoxin--NADP reductase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO2222 PE=3 SV=1 908 1153 2.0E-10
sp|Q928P3|FENR2_LISIN Ferredoxin--NADP reductase 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin2489 PE=3 SV=1 900 1152 3.0E-10
sp|B2IHR5|FENR_BEII9 Ferredoxin--NADP reductase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=Bind_2345 PE=3 SV=1 906 1188 3.0E-10
sp|O05268|FENR2_BACSU Ferredoxin--NADP reductase 2 OS=Bacillus subtilis (strain 168) GN=yumC PE=1 SV=2 899 1187 4.0E-10
sp|Q71X35|FENR2_LISMF Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=LMOf2365_2364 PE=3 SV=1 900 1139 4.0E-10
sp|Q04HB6|FENR_OENOB Ferredoxin--NADP reductase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=OEOE_0163 PE=3 SV=1 908 1100 5.0E-10
sp|Q5WDV1|FENR2_BACSK Ferredoxin--NADP reductase 2 OS=Bacillus clausii (strain KSM-K16) GN=ABC2925 PE=3 SV=1 908 1092 5.0E-10
sp|A4ISE6|FENR_GEOTN Ferredoxin--NADP reductase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=GTNG_2905 PE=3 SV=1 908 1119 5.0E-10
sp|Q8DYW9|FENR_STRA5 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=SAG1353 PE=3 SV=1 908 1143 1.0E-09
sp|Q8E4H8|FENR_STRA3 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=gbs1423 PE=3 SV=1 908 1143 1.0E-09
sp|Q3K0F9|FENR_STRA1 Ferredoxin--NADP reductase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=SAK_1384 PE=3 SV=1 908 1143 1.0E-09
sp|A7Z8C1|FENR2_BACMF Ferredoxin--NADP reductase 2 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=RBAM_029160 PE=3 SV=1 899 1187 1.0E-09
sp|A7GUD5|FENR2_BACCN Ferredoxin--NADP reductase 2 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=Bcer98_3539 PE=3 SV=1 908 1101 2.0E-09
sp|Q5KVP7|FENR_GEOKA Ferredoxin--NADP reductase OS=Geobacillus kaustophilus (strain HTA426) GN=GK2954 PE=3 SV=1 908 1187 2.0E-09
sp|Q8Y4P5|FENR2_LISMO Ferredoxin--NADP reductase 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo2390 PE=3 SV=1 900 1152 3.0E-09
sp|Q816D9|FENR_BACCR Ferredoxin--NADP reductase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_4926 PE=3 SV=1 908 1101 4.0E-09
sp|Q67QU3|FENR_SYMTH Ferredoxin--NADP reductase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH965 PE=3 SV=1 908 1190 4.0E-09
sp|Q8DP13|FENR_STRR6 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=spr1421 PE=3 SV=1 908 1152 4.0E-09
sp|Q04JI5|FENR_STRP2 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=SPD_1393 PE=3 SV=1 908 1152 4.0E-09
sp|Q632D6|FENR_BACCZ Ferredoxin--NADP reductase OS=Bacillus cereus (strain ZK / E33L) GN=BCE33L4658 PE=3 SV=1 908 1101 4.0E-09
sp|Q6HBX6|FENR2_BACHK Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=BT9727_4639 PE=3 SV=1 908 1101 4.0E-09
sp|Q72YF6|FENR2_BACC1 Ferredoxin--NADP reductase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_5065 PE=3 SV=1 908 1101 4.0E-09
sp|Q81XS0|FENR2_BACAN Ferredoxin--NADP reductase 2 OS=Bacillus anthracis GN=BA_5160 PE=3 SV=1 908 1101 4.0E-09
sp|A0RKB9|FENR2_BACAH Ferredoxin--NADP reductase 2 OS=Bacillus thuringiensis (strain Al Hakam) GN=BALH_4465 PE=3 SV=1 908 1101 4.0E-09
sp|A8FH11|FENR2_BACP2 Ferredoxin--NADP reductase 2 OS=Bacillus pumilus (strain SAFR-032) GN=BPUM_2873 PE=3 SV=1 899 1187 1.0E-08
sp|B1ICY3|FENR_STRPI Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=SPH_1677 PE=3 SV=1 908 1152 1.0E-08
sp|Q8DUN5|FENR_STRMU Ferredoxin--NADP reductase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=SMU_869 PE=3 SV=1 908 1121 2.0E-08
sp|Q8ETS1|FENR1_OCEIH Ferredoxin--NADP reductase 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=OB0186 PE=3 SV=1 908 1187 2.0E-08
sp|A9VMZ3|FENR2_BACWK Ferredoxin--NADP reductase 2 OS=Bacillus weihenstephanensis (strain KBAB4) GN=BcerKBAB4_4748 PE=3 SV=1 908 1101 3.0E-08
sp|B1MX70|FENR_LEUCK Ferredoxin--NADP reductase OS=Leuconostoc citreum (strain KM20) GN=LCK_00289 PE=3 SV=2 908 1106 6.0E-08
sp|Q38YJ1|FENR2_LACSS Ferredoxin--NADP reductase 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=LCA_0435 PE=3 SV=1 908 1101 8.0E-08
sp|Q98M06|FENR_RHILO Ferredoxin--NADP reductase OS=Rhizobium loti (strain MAFF303099) GN=mll0792 PE=3 SV=1 904 1141 9.0E-08
sp|B5E6K6|FENR_STRP4 Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=SPG_1489 PE=3 SV=1 908 1152 1.0E-07
sp|Q2GCZ2|FENR_NEOSM Ferredoxin--NADP reductase OS=Neorickettsia sennetsu (strain Miyayama) GN=NSE_0779 PE=3 SV=1 904 1187 2.0E-07
sp|B2IR81|FENR_STRPS Ferredoxin--NADP reductase OS=Streptococcus pneumoniae (strain CGSP14) GN=SPCG_1548 PE=3 SV=1 908 1152 2.0E-07
sp|Q97PP0|FENR_STRPN Ferredoxin--NADP reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=SP_1563 PE=3 SV=1 908 1152 2.0E-07
sp|Q03JS2|FENR_STRTD Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=STER_1382 PE=3 SV=1 908 1122 3.0E-07
sp|Q5M3J6|FENR_STRT2 Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=stu1417 PE=3 SV=1 908 1122 3.0E-07
sp|Q5LYY3|FENR_STRT1 Ferredoxin--NADP reductase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=str1417 PE=3 SV=1 908 1122 3.0E-07
sp|B1HW35|FENR3_LYSSC Ferredoxin--NADP reductase 3 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_2322 PE=3 SV=1 908 1092 4.0E-07
sp|Q65FE0|FENR2_BACLD Ferredoxin--NADP reductase 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=BLi03393 PE=3 SV=1 908 1187 4.0E-07
sp|Q4J6Z4|FENR2_SULAC Ferredoxin--NADP reductase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_2144 PE=3 SV=1 945 1153 4.0E-07
sp|B1I067|FENR2_LYSSC Ferredoxin--NADP reductase 2 OS=Lysinibacillus sphaericus (strain C3-41) GN=Bsph_0993 PE=3 SV=1 908 1120 6.0E-07
sp|P80892|TRXB_ALIFS Thioredoxin reductase (Fragment) OS=Aliivibrio fischeri GN=trxB PE=1 SV=1 905 949 7.0E-07
sp|A3CM39|FENR_STRSV Ferredoxin--NADP reductase OS=Streptococcus sanguinis (strain SK36) GN=SSA_0813 PE=3 SV=1 908 1152 8.0E-07
sp|Q2W0C9|FENR_MAGSA Ferredoxin--NADP reductase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=amb3892 PE=3 SV=1 906 1187 9.0E-07
sp|Q89HV6|FENR_BRADU Ferredoxin--NADP reductase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=bll5883 PE=3 SV=1 904 1141 9.0E-07
sp|Q73GH2|FENR_WOLPM Ferredoxin--NADP reductase OS=Wolbachia pipientis wMel GN=WD_0982 PE=3 SV=1 904 1140 9.0E-07
sp|A5EMW5|FENR_BRASB Ferredoxin--NADP reductase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=BBta_5550 PE=3 SV=1 904 1134 1.0E-06
sp|Q03ZE9|FENR_LEUMM Ferredoxin--NADP reductase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=LEUM_0297 PE=3 SV=1 908 1100 1.0E-06
sp|A4SVT8|FENR_POLSQ Ferredoxin--NADP reductase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=Pnuc_0382 PE=3 SV=1 904 1177 1.0E-06
sp|A9NFF6|FENR_ACHLI Ferredoxin--NADP reductase OS=Acholeplasma laidlawii (strain PG-8A) GN=ACL_0467 PE=3 SV=2 907 1187 3.0E-06
sp|Q8Y5U4|FENR1_LISMO Ferredoxin--NADP reductase 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo1961 PE=3 SV=1 908 1189 3.0E-06
sp|A8AXQ6|FENR_STRGC Ferredoxin--NADP reductase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=SGO_1284 PE=3 SV=1 908 1152 4.0E-06
sp|Q73EA6|FENR1_BACC1 Ferredoxin--NADP reductase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0452 PE=3 SV=1 908 1187 4.0E-06
sp|Q88UC0|FENR_LACPL Ferredoxin--NADP reductase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_2585 PE=3 SV=1 908 1120 5.0E-06
sp|A4VXW3|FENR_STRSY Ferredoxin--NADP reductase OS=Streptococcus suis (strain 05ZYH33) GN=SSU05_1986 PE=3 SV=1 908 1092 5.0E-06
sp|A4W460|FENR_STRS2 Ferredoxin--NADP reductase OS=Streptococcus suis (strain 98HAH33) GN=SSU98_1991 PE=3 SV=2 908 1092 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1994
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|769
Ophiocordyceps australis map64 (Brazil) OphauB2|4390
Ophiocordyceps camponoti-floridani Ophcf2|02271
Ophiocordyceps camponoti-rufipedis Ophun1|3174 (this protein)
Ophiocordyceps kimflemingae Ophio5|5108
Ophiocordyceps subramaniannii Hirsu2|222

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3174
MLVRYRTTGPRIDPDTVSLGRDALADGIEGFERHPWAVAPAKMNGSVGGALPLDAADYDAMDHLNLLFSQPSAIS
SISQVSHRLRARQNELSDEMEALELAQAYKPNSSLERMQSAQSELAQLFRKIETVRSRAIETEQNITSMTADIKR
LDGTKRNLTLSMTALKRLQMLTTAYEQLRGLAKARQYRECAGLLQAVVQLMKHFNSYRSIEQIATLSREVSELQR
QLLEQICEDFEMAFAKSEVSSSKGMLIEACYVMDALGESAKSRLTTWYVNTELREYRQLFRGNDEAGSLDNIGRR
YAWFKRMMKTHDEEHATLFPPHWHINELLATAFCEGTRDDFRGILERSMRRSDGHKVDVNLLLSCLQETLDFEQG
LERRFFAEARGSIDTLSSAEERSQSFGGLISTAFEPYLSLWVESQDRQLASMMPKYRSQAPLPPGDEFSPQAVMT
SAIELFHFYKLTLSQCARLSPNESLLDLSRTLAKYLDEYAQQVLLHRLQGGPSVQDAVLVLNTADFWHVNTNQLE
DNIKKRIEAELAPKVDLTSQSDAFLGVASAAVLALVHMVELDCEGVWREMRNTNWSSMDSAGDQSSYVGELVKHV
DDKAREMLAVVSKQQYARAFCDHLVEHLATSFLNNMVQCRPISEVGAQQMLVDKYALTKSFGKLLSHHNPSPSPS
SSSFVRRVEQSMNRMDPLLKTLQVRAAPPEGLVQAYLIHIADRSDTNFRKILDLKGVRKKDQAHLMELFAIHRES
GSNDKQLAASSALLTPLMSGSTNALSGASDGRFDAGSLGEKLLSAARDMGAAGGSSERGTPPSGVEKATINENLR
SIGKFFRKDFGGLGARFGKRDGSVGAEERQRDVIPLSRRETQETSKLFASRFSRTLKSSAGLTTVATAIGLQNQQ
KTRMHSKVVIIGSGPAAHTAAVYLARAELKPVLYEGFMANGTAAGGQLTTTTEVENYPGFEKGIMGQELMDKMRA
QSERFGTTIVTDTVTKLDLSTRPFRYSTEFSPDETHTADAVVIATGASARRLNLKGEEEYWQKGISACAVCDGAL
PIFRKKPLYVIGGGDSAAEEATFLTKYASHVTVLVRRDVLRASKTMASRLLAHEKVTVRFNASATEIRGPGGDGC
MSHLVVKDNVTGKTEVVEASGLFYAVGHDPATALVKGQVKVDDEGYIVTTPGTASTSVAGYYQCW*
Coding >Ophun1|3174
ATGTTAGTGAGGTATAGGACGACCGGCCCGCGGATTGATCCGGATACCGTGTCCCTCGGACGTGACGCGTTGGCC
GATGGCATCGAAGGATTCGAGCGCCATCCTTGGGCCGTTGCTCCTGCGAAGATGAACGGCAGCGTTGGGGGGGCC
CTGCCCTTGGACGCGGCCGATTACGATGCCATGGACCACCTCAACCTGCTCTTCTCGCAGCCGTCGGCCATCTCG
TCCATCAGCCAGGTTTCACATAGACTGCGGGCGCGGCAGAACGAGCTCTCGGACGAGATGGAGGCCCTGGAGTTG
GCGCAAGCCTACAAGCCCAACTCGAGCTTGGAGCGGATGCAGTCGGCCCAGTCGGAGCTGGCCCAGCTCTTCCGC
AAGATCGAGACGGTACGATCGCGAGCCATCGAGACGGAGCAGAATATTACGTCGATGACGGCGGACATCAAGCGG
CTCGACGGCACCAAGCGGAACCTGACGCTCAGCATGACGGCCCTCAAGCGGCTGCAGATGCTGACGACGGCCTAC
GAGCAGCTGCGTGGCCTGGCCAAGGCGCGGCAGTATCGCGAGTGCGCCGGTCTGCTGCAAGCTGTTGTTCAGCTC
ATGAAGCACTTCAATAGTTACCGAAGCATTGAGCAGATTGCGACGCTGAGCCGTGAGGTGTCGGAGCTGCAGCGC
CAACTGCTGGAGCAGATCTGCGAGGACTTTGAGATGGCTTTTGCTAAATCCGAGGTATCGTCCAGCAAGGGCATG
TTGATCGAGGCCTGCTACGTCATGGACGCCCTGGGGGAATCTGCCAAGTCGCGGCTCACGACATGGTACGTCAAC
ACGGAGCTGCGCGAGTACCGGCAGCTGTTCCGGGGCAACGACGAGGCAGGGAGCCTCGACAATATCGGCCGACGC
TACGCCTGGTTCAAGCGCATGATGAAGACGCACGACGAGGAGCACGCCACGCTGTTCCCGCCGCACTGGCACATC
AACGAGCTGCTGGCCACGGCATTTTGTGAAGGCACGCGCGACGACTTTCGGGGCATTCTCGAGCGGAGTATGCGC
CGAAGCGACGGTCACAAGGTCGACGTCAACCTGCTGCTCAGCTGCTTGCAAGAGACGCTCGACTTTGAGCAGGGA
TTGGAGAGGCGCTTCTTCGCCGAGGCCCGGGGCAGCATCGACACGCTGAGCTCGGCCGAGGAGAGGTCACAAAGC
TTCGGCGGCCTGATCTCGACCGCCTTCGAGCCCTACCTCAGTCTCTGGGTCGAGTCTCAGGACAGGCAGCTGGCG
TCGATGATGCCCAAGTACCGCAGCCAGGCGCCGCTGCCCCCGGGCGACGAGTTTTCGCCACAGGCCGTCATGACG
TCGGCCATTGAGCTGTTTCACTTCTACAAGCTCACGCTGTCGCAGTGCGCGAGGCTGTCACCAAACGAGAGCCTC
CTGGATCTGTCGAGGACGCTGGCCAAGTACTTGGACGAGTACGCGCAGCAGGTGCTGCTGCACAGGCTGCAGGGC
GGGCCGTCGGTTCAGGACGCGGTGCTGGTGCTCAACACGGCCGACTTTTGGCACGTCAACACGAACCAGCTCGAG
GACAACATCAAGAAGCGGATCGAGGCGGAGCTGGCGCCCAAGGTGGACCTGACGTCGCAGTCGGACGCCTTTCTG
GGCGTGGCGAGCGCGGCGGTGCTTGCGCTGGTGCACATGGTGGAGCTGGACTGCGAGGGCGTCTGGCGGGAGATG
AGAAACACCAACTGGAGCAGCATGGACAGCGCCGGCGATCAGAGCTCGTACGTGGGCGAGCTGGTCAAGCATGTG
GACGACAAGGCGCGCGAGATGCTGGCCGTCGTCAGCAAGCAGCAGTACGCGAGGGCCTTTTGCGATCACCTGGTG
GAGCACCTGGCCACGAGCTTCCTCAACAACATGGTGCAGTGTCGGCCCATCTCCGAGGTTGGCGCTCAGCAGATG
CTCGTCGACAAGTACGCGCTCACCAAATCGTTTGGGAAGCTCCTGTCGCATCACAACCCGTCGCCGTCGCCCAGC
AGCAGCAGCTTCGTGCGGCGGGTCGAGCAGTCGATGAACCGGATGGACCCGCTGCTCAAGACGTTGCAAGTTCGA
GCAGCGCCGCCCGAGGGCCTGGTGCAGGCGTACCTGATTCACATTGCGGACCGGTCCGACACCAACTTTCGCAAG
ATCCTCGACCTCAAGGGCGTGCGCAAGAAGGACCAGGCGCACCTGATGGAGCTGTTCGCCATCCACCGCGAAAGC
GGCTCCAACGACAAGCAGCTGGCGGCGAGCTCGGCGCTGCTGACGCCCCTCATGTCGGGGAGCACCAACGCCCTG
AGCGGAGCCTCGGATGGCCGGTTCGACGCCGGATCTCTGGGGGAGAAGCTGCTGAGCGCGGCGAGGGACATGGGC
GCCGCGGGGGGTTCGTCGGAGCGAGGGACTCCTCCGAGCGGCGTGGAGAAGGCGACGATCAACGAGAACCTGCGA
AGCATCGGAAAGTTCTTTAGAAAGGACTTTGGTGGGCTGGGAGCGCGTTTCGGGAAGCGGGATGGGAGTGTGGGC
GCGGAGGAGAGGCAGCGCGACGTCATTCCTCTGTCCCGTCGCGAAACCCAGGAAACCAGCAAACTGTTCGCCTCA
CGATTCTCGCGGACGCTGAAATCGAGCGCCGGATTGACGACGGTGGCGACGGCGATTGGGCTGCAGAATCAGCAG
AAGACAAGGATGCATAGCAAGGTCGTCATCATTGGGTCGGGGCCCGCGGCTCATACGGCGGCCGTTTACCTGGCC
AGAGCGGAGTTGAAGCCCGTCTTGTACGAGGGCTTCATGGCCAACGGGACGGCGGCGGGCGGCCAGCTGACGACG
ACGACCGAGGTGGAAAACTACCCTGGTTTCGAAAAGGGTATCATGGGCCAGGAGCTGATGGACAAGATGCGCGCG
CAATCAGAACGATTCGGCACCACCATCGTGACAGACACGGTGACGAAGCTGGACCTCTCGACGCGTCCCTTTCGC
TACAGCACCGAGTTCAGCCCGGACGAGACGCACACGGCCGACGCCGTCGTCATCGCAACGGGCGCCTCGGCGCGA
CGACTTAACCTAAAGGGCGAGGAGGAATACTGGCAGAAGGGCATCTCTGCCTGCGCTGTATGCGACGGGGCGCTC
CCCATCTTCCGCAAGAAGCCTCTCTACGTCATCGGCGGCGGCGACTCGGCGGCTGAGGAGGCGACGTTCCTGACC
AAGTACGCGAGTCACGTCACCGTCCTCGTCCGACGCGACGTGCTGCGCGCGAGCAAGACGATGGCTTCGCGCTTG
CTGGCACACGAAAAGGTGACGGTCCGCTTCAACGCTTCGGCCACGGAGATTCGCGGGCCGGGGGGTGACGGGTGC
ATGAGCCACCTCGTCGTCAAGGACAACGTGACGGGAAAGACGGAGGTGGTGGAAGCGAGCGGCCTTTTCTACGCC
GTCGGTCACGATCCGGCCACGGCGCTGGTCAAGGGGCAGGTCAAGGTGGATGACGAGGGCTACATCGTTACCACG
CCGGGGACGGCTAGCACGAGTGTTGCTGGCTATTACCAGTGCTGGTGA
Transcript >Ophun1|3174
ATGTTAGTGAGGTATAGGACGACCGGCCCGCGGATTGATCCGGATACCGTGTCCCTCGGACGTGACGCGTTGGCC
GATGGCATCGAAGGATTCGAGCGCCATCCTTGGGCCGTTGCTCCTGCGAAGATGAACGGCAGCGTTGGGGGGGCC
CTGCCCTTGGACGCGGCCGATTACGATGCCATGGACCACCTCAACCTGCTCTTCTCGCAGCCGTCGGCCATCTCG
TCCATCAGCCAGGTTTCACATAGACTGCGGGCGCGGCAGAACGAGCTCTCGGACGAGATGGAGGCCCTGGAGTTG
GCGCAAGCCTACAAGCCCAACTCGAGCTTGGAGCGGATGCAGTCGGCCCAGTCGGAGCTGGCCCAGCTCTTCCGC
AAGATCGAGACGGTACGATCGCGAGCCATCGAGACGGAGCAGAATATTACGTCGATGACGGCGGACATCAAGCGG
CTCGACGGCACCAAGCGGAACCTGACGCTCAGCATGACGGCCCTCAAGCGGCTGCAGATGCTGACGACGGCCTAC
GAGCAGCTGCGTGGCCTGGCCAAGGCGCGGCAGTATCGCGAGTGCGCCGGTCTGCTGCAAGCTGTTGTTCAGCTC
ATGAAGCACTTCAATAGTTACCGAAGCATTGAGCAGATTGCGACGCTGAGCCGTGAGGTGTCGGAGCTGCAGCGC
CAACTGCTGGAGCAGATCTGCGAGGACTTTGAGATGGCTTTTGCTAAATCCGAGGTATCGTCCAGCAAGGGCATG
TTGATCGAGGCCTGCTACGTCATGGACGCCCTGGGGGAATCTGCCAAGTCGCGGCTCACGACATGGTACGTCAAC
ACGGAGCTGCGCGAGTACCGGCAGCTGTTCCGGGGCAACGACGAGGCAGGGAGCCTCGACAATATCGGCCGACGC
TACGCCTGGTTCAAGCGCATGATGAAGACGCACGACGAGGAGCACGCCACGCTGTTCCCGCCGCACTGGCACATC
AACGAGCTGCTGGCCACGGCATTTTGTGAAGGCACGCGCGACGACTTTCGGGGCATTCTCGAGCGGAGTATGCGC
CGAAGCGACGGTCACAAGGTCGACGTCAACCTGCTGCTCAGCTGCTTGCAAGAGACGCTCGACTTTGAGCAGGGA
TTGGAGAGGCGCTTCTTCGCCGAGGCCCGGGGCAGCATCGACACGCTGAGCTCGGCCGAGGAGAGGTCACAAAGC
TTCGGCGGCCTGATCTCGACCGCCTTCGAGCCCTACCTCAGTCTCTGGGTCGAGTCTCAGGACAGGCAGCTGGCG
TCGATGATGCCCAAGTACCGCAGCCAGGCGCCGCTGCCCCCGGGCGACGAGTTTTCGCCACAGGCCGTCATGACG
TCGGCCATTGAGCTGTTTCACTTCTACAAGCTCACGCTGTCGCAGTGCGCGAGGCTGTCACCAAACGAGAGCCTC
CTGGATCTGTCGAGGACGCTGGCCAAGTACTTGGACGAGTACGCGCAGCAGGTGCTGCTGCACAGGCTGCAGGGC
GGGCCGTCGGTTCAGGACGCGGTGCTGGTGCTCAACACGGCCGACTTTTGGCACGTCAACACGAACCAGCTCGAG
GACAACATCAAGAAGCGGATCGAGGCGGAGCTGGCGCCCAAGGTGGACCTGACGTCGCAGTCGGACGCCTTTCTG
GGCGTGGCGAGCGCGGCGGTGCTTGCGCTGGTGCACATGGTGGAGCTGGACTGCGAGGGCGTCTGGCGGGAGATG
AGAAACACCAACTGGAGCAGCATGGACAGCGCCGGCGATCAGAGCTCGTACGTGGGCGAGCTGGTCAAGCATGTG
GACGACAAGGCGCGCGAGATGCTGGCCGTCGTCAGCAAGCAGCAGTACGCGAGGGCCTTTTGCGATCACCTGGTG
GAGCACCTGGCCACGAGCTTCCTCAACAACATGGTGCAGTGTCGGCCCATCTCCGAGGTTGGCGCTCAGCAGATG
CTCGTCGACAAGTACGCGCTCACCAAATCGTTTGGGAAGCTCCTGTCGCATCACAACCCGTCGCCGTCGCCCAGC
AGCAGCAGCTTCGTGCGGCGGGTCGAGCAGTCGATGAACCGGATGGACCCGCTGCTCAAGACGTTGCAAGTTCGA
GCAGCGCCGCCCGAGGGCCTGGTGCAGGCGTACCTGATTCACATTGCGGACCGGTCCGACACCAACTTTCGCAAG
ATCCTCGACCTCAAGGGCGTGCGCAAGAAGGACCAGGCGCACCTGATGGAGCTGTTCGCCATCCACCGCGAAAGC
GGCTCCAACGACAAGCAGCTGGCGGCGAGCTCGGCGCTGCTGACGCCCCTCATGTCGGGGAGCACCAACGCCCTG
AGCGGAGCCTCGGATGGCCGGTTCGACGCCGGATCTCTGGGGGAGAAGCTGCTGAGCGCGGCGAGGGACATGGGC
GCCGCGGGGGGTTCGTCGGAGCGAGGGACTCCTCCGAGCGGCGTGGAGAAGGCGACGATCAACGAGAACCTGCGA
AGCATCGGAAAGTTCTTTAGAAAGGACTTTGGTGGGCTGGGAGCGCGTTTCGGGAAGCGGGATGGGAGTGTGGGC
GCGGAGGAGAGGCAGCGCGACGTCATTCCTCTGTCCCGTCGCGAAACCCAGGAAACCAGCAAACTGTTCGCCTCA
CGATTCTCGCGGACGCTGAAATCGAGCGCCGGATTGACGACGGTGGCGACGGCGATTGGGCTGCAGAATCAGCAG
AAGACAAGGATGCATAGCAAGGTCGTCATCATTGGGTCGGGGCCCGCGGCTCATACGGCGGCCGTTTACCTGGCC
AGAGCGGAGTTGAAGCCCGTCTTGTACGAGGGCTTCATGGCCAACGGGACGGCGGCGGGCGGCCAGCTGACGACG
ACGACCGAGGTGGAAAACTACCCTGGTTTCGAAAAGGGTATCATGGGCCAGGAGCTGATGGACAAGATGCGCGCG
CAATCAGAACGATTCGGCACCACCATCGTGACAGACACGGTGACGAAGCTGGACCTCTCGACGCGTCCCTTTCGC
TACAGCACCGAGTTCAGCCCGGACGAGACGCACACGGCCGACGCCGTCGTCATCGCAACGGGCGCCTCGGCGCGA
CGACTTAACCTAAAGGGCGAGGAGGAATACTGGCAGAAGGGCATCTCTGCCTGCGCTGTATGCGACGGGGCGCTC
CCCATCTTCCGCAAGAAGCCTCTCTACGTCATCGGCGGCGGCGACTCGGCGGCTGAGGAGGCGACGTTCCTGACC
AAGTACGCGAGTCACGTCACCGTCCTCGTCCGACGCGACGTGCTGCGCGCGAGCAAGACGATGGCTTCGCGCTTG
CTGGCACACGAAAAGGTGACGGTCCGCTTCAACGCTTCGGCCACGGAGATTCGCGGGCCGGGGGGTGACGGGTGC
ATGAGCCACCTCGTCGTCAAGGACAACGTGACGGGAAAGACGGAGGTGGTGGAAGCGAGCGGCCTTTTCTACGCC
GTCGGTCACGATCCGGCCACGGCGCTGGTCAAGGGGCAGGTCAAGGTGGATGACGAGGGCTACATCGTTACCACG
CCGGGGACGGCTAGCACGAGTGTTGCTGGCTATTACCAGTGCTGGTGA
Gene >Ophun1|3174
ATGTTAGTGAGGTATAGGGTAGGCGGAGGCTGGTCGGATCTCGGTCGAGCTACGCCGGTTGAAATCGGCTGGATC
GACCTTCTTGACGATCGGTTGGTCTAATCTCTCGTATCTGCGAATAGCCAACCGCTGCCGCACTCTTATGAATAT
CTATTCTTTGACTCATTCTCCTCTTCCCGCTGCCTTCCCACATCAGCTAAGAGAGCTGACGACAGACGACCGGCC
CGCGGATTGATCCGGATACCGTGTCCCTCGGACGTGACGCGTTGGCCGATGGCATCGAAGGATTCGAGCGCCATC
CTTGGGCCGTTGCTCCTGCGAAGATGAACGGCAGCGTTGGGGGGGCCCTGCCCTTGGACGCGGGTGAGGCTATAC
CCATCTCCCGCTGCCGGAAATCAACTGGTGGCTGACGGGCGAGGCAGCCGATTACGATGCCATGGACCACCTCAA
CCTGCTCTTCTCGCAGCCGTCGGCCATCTCGTCCATCAGCCAGGTTTCACATAGACTGCGGGCGCGGCAGAACGA
GCTCTCGGACGAGATGGAGGCCCTGGAGTTGGCGCAAGCCTACAAGCCCAACTCGAGCTTGGAGCGGATGCAGTC
GGCCCAGTCGGAGCTGGCCCAGCTCTTCCGCAAGATCGAGACGGTACGATCGCGAGCCATCGAGACGGAGCAGAA
TATTACGTCGATGACGGCGGACATCAAGCGGCTCGACGGCACCAAGCGGAACCTGACGCTCAGCATGACGGCCCT
CAAGCGGCTGCAGATGCTGACGACGGCCTACGAGCAGCTGCGTGGCCTGGCCAAGGCGCGGCAGTATCGCGAGTG
CGCCGGTCTGCTGCAAGCTGTTGTTCAGCTCATGAAGCACTTCAATAGTTACCGAAGCATTGAGCAGATTGCGAC
GCTGAGCCGTGAGGTGTCGGAGCTGCAGCGCCAACTGCTGGAGCAGATCTGCGAGGACTTTGAGATGGCTTTTGC
TAAATCCGAGGTATCGTCCAGCAAGGGCATGTTGATCGAGGCCTGCTACGTCATGGACGCCCTGGGGGAATCTGC
CAAGTCGCGGCTCACGACATGGTACGTCAACACGGAGCTGCGCGAGTACCGGCAGCTGTTCCGGGGCAACGACGA
GGCAGGGAGCCTCGACAATATCGGCCGACGCTACGCCTGGTTCAAGCGCATGATGAAGACGCACGACGAGGAGCA
CGCCACGCTGTTCCCGCCGCACTGGCACATCAACGAGCTGCTGGCCACGGCATTTTGTGAAGGCACGCGCGACGA
CTTTCGGGGCATTCTCGAGCGGAGTATGCGCCGAAGCGACGGTCACAAGGTCGACGTCAACCTGCTGCTCAGCTG
CTTGCAAGAGACGCTCGACTTTGAGCAGGGATTGGAGAGGCGCTTCTTCGCCGAGGCCCGGGGCAGCATCGACAC
GCTGAGCTCGGCCGAGGAGAGGTCACAAAGCTTCGGCGGCCTGATCTCGACCGCCTTCGAGCCCTACCTCAGTCT
CTGGGTCGAGTCTCAGGACAGGCAGCTGGCGTCGATGATGCCCAAGTACCGCAGCCAGGCGCCGCTGCCCCCGGG
CGACGAGTTTTCGCCACAGGCCGTCATGACGTCGGCCATTGAGCTGTTTCACTTCTACAAGCTCACGCTGTCGCA
GTGCGCGAGGCTGTCACCAAACGAGAGCCTCCTGGATCTGTCGAGGACGCTGGCCAAGTACTTGGACGAGTACGC
GCAGCAGGTGCTGCTGCACAGGCTGCAGGGCGGGCCGTCGGTTCAGGACGCGGTGCTGGTGCTCAACACGGCCGA
CTTTTGGCACGTCAACACGAACCAGCTCGAGGACAACATCAAGAAGCGGATCGAGGCGGAGCTGGCGCCCAAGGT
GGACCTGACGTCGCAGTCGGACGCCTTTCTGGGCGTGGCGAGCGCGGCGGTGCTTGCGCTGGTGCACATGGTGGA
GCTGGACTGCGAGGGCGTCTGGCGGGAGATGAGAAACACCAACTGGAGCAGCATGGACAGCGCCGGCGATCAGAG
CTCGTACGTGGGCGAGCTGGTCAAGCATGTGGACGACAAGGCGCGCGAGATGCTGGCCGTCGTCAGCAAGCAGCA
GTACGCGAGGGCCTTTTGCGATCACCTGGTGGAGCACCTGGCCACGAGCTTCCTCAACAACATGGTGCAGTGTCG
GCCCATCTCCGAGGTTGGCGCTCAGCAGGTAAGCAAGCAGAGTGTGACGGTGTCGGGAGAGCAGTCGCGCTGATG
AGAGGTCCCTCTACAGATGCTCGTCGACAAGTACGCGCTCACCAAATCGTTTGGGAAGCTCCTGTCGCATCACAA
CCCGTCGCCGTCGCCCAGCAGCAGCAGCTTCGTGCGGCGGGTCGAGCAGTCGATGAACCGGATGGACCCGCTGCT
CAAGACGTTGCAAGTTCGAGCAGCGCCGCCCGAGGGCCTGGTGCAGGCGTACCTGATTCACATTGCGGACCGGTC
CGACACCAACTTTCGCAAGATCCTCGACCTCAAGGGCGTGCGCAAGAAGGACCAGGCGCACCTGATGGAGCTGTT
CGCCATCCACCGCGAAAGCGGCTCCAACGACAAGCAGCTGGCGGCGAGCTCGGCGCTGCTGACGCCCCTCATGTC
GGGGAGCACCAACGCCCTGAGCGGAGCCTCGGATGGCCGGTTCGACGCCGGATCTCTGGGGGAGAAGCTGCTGAG
CGCGGCGAGGGACATGGGCGCCGCGGGGGGTTCGTCGGAGCGAGGGACTCCTCCGAGCGGCGTGGAGAAGGCGAC
GATCAACGAGAACCTGCGAAGCATCGGAAAGTTCTTTAGAAAGGACTTTGGTGGGCTGGGAGCGCGTTTCGGGAA
GCGGGATGGGAGTGTGGGCGCGGAGGAGAGGCAGCGGTAGGCTGATGGGGGAGGTTTGGATGTCGTCAGTGGCCA
CGGTGATGTAACGATTTGCATGTACGATGAGACGGATCTCATTGTGAGGTGTGTACTTCGTACGAAGCATTCGTT
GAAGAGCATCAAGATGATGTGGTTGACGTCGCCAAGACCACAAATATTCTAGAAGCCATCTAGAAGCGGTCCCTC
TTTTTTCGGCTTCTTTGCATGACTGCATGTGACTGCAACCCTTGACCCGCTTAGTAACACGGGTTGACGCAAAAT
CGAGCAAAGCAATCGCAACGGCATGTTCCTCTGACACCATCAGCGACGTCATTCCTCTGTCCCGTCGCGAAACCC
AGGAAACCAGCAAACTGTTCGCCTCACGATTCTCGCGGACGCTGAAATCGAGCGCCGGATTGACGACGGTGGCGA
CGGCGATTGGGCTGCAGAATCAGCAGAAGACAAGGATGCATAGCAAGGTCGTCAGTACGTCAACGCCCACGCCTC
CGATGCGAGAAGAAGCCATTTGTTGACGGCGAGGAATTGAAAGTCATTGGGTCGGGGCCCGCGGCTCATACGGCG
GCCGTTTACCTGGCCAGAGCGGAGTTGAAGCGTGAGTCGGAACTCGGTAGTCATGAGGCGCTGGCTGACGGAGAT
AGCCGTCTTGTACGAGGGCTTCATGGCCAACGGGACGGCGGCGGGCGGCCAGCTGACGACGACGACCGAGGTGGA
AAACTACCCTGGTTTCGAAAAGGGTATCATGGGCCAGGAGCTGATGGTGAGGTCTGCGATGAGCCGCGTCCGTAC
GTGAGCCTGACGTTCTCCTCCAGGACAAGATGCGCGCGCAATCAGAACGATTCGGCACCACCATCGTGACAGACA
CGGTGACGAAGCTGGACCTCTCGACGCGTCCCTTTCGCTACAGCACCGAGTTCAGCCCGGACGAGACGCACACGG
CCGACGCCGTCGTCATCGCAACGGGCGCCTCGGCGCGACGACTTAACCTAAAGGGCGAGGAGGAATACTGGCAGA
AGGGCATCTCTGCCTGCGCTGTATGCGACGGGGCGCTCCCCATCTTCCGCAAGAAGCCTCTCTACGTCATCGGCG
GCGGCGACTCGGCGGCTGAGGAGGCGACGTTCCTGACCAAGTACGCGAGTCACGTCACCGTCCTCGTCCGACGCG
ACGTGCTGCGCGCGAGCAAGACGATGGCTTCGCGCTTGCTGGCACACGAAAAGGTGACGGTCCGCTTCAACGCTT
CGGCCACGGAGATTCGCGGGCCGGGGGGTGACGGGTGCATGAGCCACCTCGTCGTCAAGGACAACGTGACGGGAA
AGACGGAGGTGGTGGAAGCGAGCGGCCTTTTCTACGCCGTCGGTCACGATCCGGCCACGGCGCTGGTCAAGGGGC
AGGTCAAGGTGGATGACGAGGGCTACATCGTTACCACGCCGGGGACGGCTAGCACGAGTGTTGCTGGTGTGTTTG
CGGCGGGCGATGTGCAGGATAAGCGCTATCGTCAGGCTATTACCAGTGCTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail