Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3158
Gene name
LocationContig_280:17863..20470
Strand-
Gene length (bp)2607
Transcript length (bp)1809
Coding sequence length (bp)1809
Protein length (aa) 603

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 2.9E-32 352 602

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 348 602 1.0E-54
sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 348 602 3.0E-53
sp|B2GUS6|KDM8_XENTR Lysine-specific demethylase 8 OS=Xenopus tropicalis GN=kdm8 PE=2 SV=1 348 602 1.0E-52
sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 349 602 5.0E-50
sp|Q8N371|KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 348 602 6.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 348 602 1.0E-54
sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 348 602 3.0E-53
sp|B2GUS6|KDM8_XENTR Lysine-specific demethylase 8 OS=Xenopus tropicalis GN=kdm8 PE=2 SV=1 348 602 1.0E-52
sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 349 602 5.0E-50
sp|Q8N371|KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 348 602 6.0E-50
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 362 602 1.0E-49
sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 349 602 1.0E-49
sp|Q1JP61|KDM8_BOVIN Lysine-specific demethylase 8 OS=Bos taurus GN=KDM8 PE=2 SV=1 348 602 3.0E-49
sp|Q55DF5|JMJCD_DICDI JmjC domain-containing protein D OS=Dictyostelium discoideum GN=jcdD PE=3 SV=1 348 597 1.0E-44
sp|Q54FG7|JMJCF_DICDI JmjC domain-containing protein F OS=Dictyostelium discoideum GN=jcdF PE=3 SV=1 354 601 1.0E-27
sp|Q55FB9|JMJCB_DICDI JmjC domain-containing protein B OS=Dictyostelium discoideum GN=jcdB PE=3 SV=1 352 592 6.0E-15
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 349 602 3.0E-10
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 360 602 1.0E-09
sp|Q8BLR9|HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus GN=Hif1an PE=1 SV=2 484 601 2.0E-08
sp|Q9NWT6|HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens GN=HIF1AN PE=1 SV=2 484 601 2.0E-08
sp|P59723|HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio GN=hif1an PE=2 SV=2 484 601 1.0E-07
sp|E1C7T6|TYW5_CHICK tRNA wybutosine-synthesizing protein 5 OS=Gallus gallus GN=TYW5 PE=3 SV=1 439 602 1.0E-06
sp|Q08BV2|TYW5_DANRE tRNA wybutosine-synthesizing protein 5 OS=Danio rerio GN=tyw5 PE=2 SV=1 439 601 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999732

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4098
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1002
Ophiocordyceps camponoti-floridani Ophcf2|03954
Ophiocordyceps camponoti-rufipedis Ophun1|3158 (this protein)
Ophiocordyceps kimflemingae Ophio5|1737
Ophiocordyceps kimflemingae Ophio5|1738
Ophiocordyceps subramaniannii Hirsu2|8294

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3158
MRANFLLALLPLSTANIHASPGHPSKVTKLTCGSMKDTTLPQFLNYTVLDVTKYNSDKPCVTWECVRVLMETFPD
DFIDAMDSIAGKKKHRVVNDIVADLRFVSPHRYLEFIAWVLESGGRRRRVCWLEDDVDYFPYYRDSLGALTAYLI
DPDLSDDRMYRRFVALTPGPLQPSLTACFQGDESTYQQIKLYHSELRAPSSLRFLPRFKSYDDIRWQTSQWSGLL
GRLLYEATQEVYACPAVCGCEATLEASRPMLPRDYEHFWRTLYWLMVTEKPFCLTMGTTSRKNVLFSNWIAAGGA
PNTKLLRRRLQDVASVALSRLYAYRYDAVPRFWRCLYTDALVLCAYWSLHRFEQYINTSNEPIIFTDLINNWPAL
TNHPWNQPDYLLSQTLGGRRLVPIELGRSYVDQGWGQELMPFSRFLAEHVVQQTETTGYLAQHDLFRQIPSLRRD
VTIPDYCWASVPPHPLDPSQDQATLDVPQLNAWFGPAGTITPLHTDGYHNLLCQVVGAKYIRLYPPDATPFMRPR
GSELGVDMSNTSCIDLGVLEGWDRPPDDYHEHDPSLLQGVDYRECILQPGDTLLIPIGWWHYVRSLSISFSLSFW
WN*
Coding >Ophun1|3158
ATGCGTGCCAACTTCCTACTCGCCTTGCTGCCGCTGAGCACCGCAAACATCCACGCCTCCCCCGGCCATCCAAGC
AAAGTAACCAAGCTGACGTGCGGGTCAATGAAGGACACGACGCTGCCCCAGTTCCTCAACTACACCGTCCTCGAC
GTCACCAAGTACAACTCGGATAAACCGTGTGTGACGTGGGAATGCGTCAGGGTGTTGATGGAAACCTTCCCAGAC
GACTTTATAGACGCCATGGACTCGATAGCCGGTAAAAAGAAACATCGGGTGGTCAATGACATCGTGGCAGACCTC
CGCTTCGTCAGTCCCCATCGTTACCTCGAGTTCATCGCCTGGGTTCTCGAGTCCGGAGGCCGTCGGCGGAGGGTA
TGCTGGCTCGAAGACGACGTCGACTACTTCCCCTACTATCGAGACTCCCTCGGAGCCCTGACAGCCTACCTGATC
GACCCCGACCTCAGCGACGACAGGATGTACCGCCGATTCGTCGCCCTGACGCCAGGCCCGCTGCAACCCTCCCTG
ACAGCCTGCTTCCAAGGAGACGAGAGCACCTACCAGCAAATCAAGCTGTACCACAGCGAGCTCCGAGCCCCCAGC
AGCCTACGCTTCCTCCCCCGCTTCAAGAGCTACGACGACATCCGGTGGCAGACGAGCCAGTGGAGCGGCCTCCTC
GGACGGCTGCTGTACGAGGCGACGCAGGAGGTGTACGCGTGTCCCGCGGTATGCGGATGCGAGGCGACGCTGGAG
GCTTCGCGGCCGATGCTGCCGAGGGATTATGAGCATTTCTGGCGGACGCTTTACTGGCTCATGGTGACGGAGAAG
CCGTTTTGTCTGACCATGGGGACGACGAGTCGTAAGAACGTCCTGTTTAGCAATTGGATTGCCGCTGGCGGAGCC
CCCAACACAAAGCTCCTCCGCCGCCGGCTCCAAGATGTGGCGTCGGTGGCGCTGAGCAGGCTGTACGCCTACCGA
TACGATGCCGTGCCGCGGTTCTGGCGGTGTTTGTATACGGATGCCCTGGTGCTGTGTGCTTACTGGTCCCTACAC
CGCTTCGAACAATACATCAACACAAGCAACGAACCCATCATCTTCACCGACCTCATCAACAACTGGCCCGCCCTC
ACGAACCACCCGTGGAATCAACCAGACTACCTCCTCTCCCAAACACTCGGCGGCCGACGCCTCGTCCCCATCGAG
CTGGGCCGCAGCTACGTCGATCAAGGATGGGGCCAGGAGTTGATGCCCTTTTCCCGCTTCTTGGCTGAGCATGTT
GTTCAACAGACCGAGACGACGGGCTACCTCGCGCAGCATGATCTCTTCCGCCAGATCCCCTCGTTACGCCGCGAC
GTCACCATCCCGGACTACTGCTGGGCCTCTGTCCCTCCTCATCCTCTCGATCCAAGCCAAGACCAGGCCACGCTC
GACGTGCCCCAGCTCAACGCCTGGTTCGGTCCGGCCGGTACCATCACGCCTCTGCACACCGACGGCTACCATAAC
CTCCTCTGCCAGGTCGTCGGCGCAAAATACATCCGCCTGTATCCTCCCGATGCCACGCCCTTTATGCGGCCCCGT
GGCTCTGAGCTCGGCGTCGACATGAGCAATACCAGCTGTATCGATCTGGGCGTCCTCGAGGGCTGGGATCGCCCG
CCTGATGATTACCATGAGCACGATCCGTCGCTTCTGCAGGGCGTTGACTACAGAGAGTGCATCTTGCAGCCGGGT
GATACCTTGCTGATTCCCATTGGATGGTGGCACTACGTCCGGAGCCTGAGCATCAGCTTCAGCCTCAGCTTCTGG
TGGAACTAG
Transcript >Ophun1|3158
ATGCGTGCCAACTTCCTACTCGCCTTGCTGCCGCTGAGCACCGCAAACATCCACGCCTCCCCCGGCCATCCAAGC
AAAGTAACCAAGCTGACGTGCGGGTCAATGAAGGACACGACGCTGCCCCAGTTCCTCAACTACACCGTCCTCGAC
GTCACCAAGTACAACTCGGATAAACCGTGTGTGACGTGGGAATGCGTCAGGGTGTTGATGGAAACCTTCCCAGAC
GACTTTATAGACGCCATGGACTCGATAGCCGGTAAAAAGAAACATCGGGTGGTCAATGACATCGTGGCAGACCTC
CGCTTCGTCAGTCCCCATCGTTACCTCGAGTTCATCGCCTGGGTTCTCGAGTCCGGAGGCCGTCGGCGGAGGGTA
TGCTGGCTCGAAGACGACGTCGACTACTTCCCCTACTATCGAGACTCCCTCGGAGCCCTGACAGCCTACCTGATC
GACCCCGACCTCAGCGACGACAGGATGTACCGCCGATTCGTCGCCCTGACGCCAGGCCCGCTGCAACCCTCCCTG
ACAGCCTGCTTCCAAGGAGACGAGAGCACCTACCAGCAAATCAAGCTGTACCACAGCGAGCTCCGAGCCCCCAGC
AGCCTACGCTTCCTCCCCCGCTTCAAGAGCTACGACGACATCCGGTGGCAGACGAGCCAGTGGAGCGGCCTCCTC
GGACGGCTGCTGTACGAGGCGACGCAGGAGGTGTACGCGTGTCCCGCGGTATGCGGATGCGAGGCGACGCTGGAG
GCTTCGCGGCCGATGCTGCCGAGGGATTATGAGCATTTCTGGCGGACGCTTTACTGGCTCATGGTGACGGAGAAG
CCGTTTTGTCTGACCATGGGGACGACGAGTCGTAAGAACGTCCTGTTTAGCAATTGGATTGCCGCTGGCGGAGCC
CCCAACACAAAGCTCCTCCGCCGCCGGCTCCAAGATGTGGCGTCGGTGGCGCTGAGCAGGCTGTACGCCTACCGA
TACGATGCCGTGCCGCGGTTCTGGCGGTGTTTGTATACGGATGCCCTGGTGCTGTGTGCTTACTGGTCCCTACAC
CGCTTCGAACAATACATCAACACAAGCAACGAACCCATCATCTTCACCGACCTCATCAACAACTGGCCCGCCCTC
ACGAACCACCCGTGGAATCAACCAGACTACCTCCTCTCCCAAACACTCGGCGGCCGACGCCTCGTCCCCATCGAG
CTGGGCCGCAGCTACGTCGATCAAGGATGGGGCCAGGAGTTGATGCCCTTTTCCCGCTTCTTGGCTGAGCATGTT
GTTCAACAGACCGAGACGACGGGCTACCTCGCGCAGCATGATCTCTTCCGCCAGATCCCCTCGTTACGCCGCGAC
GTCACCATCCCGGACTACTGCTGGGCCTCTGTCCCTCCTCATCCTCTCGATCCAAGCCAAGACCAGGCCACGCTC
GACGTGCCCCAGCTCAACGCCTGGTTCGGTCCGGCCGGTACCATCACGCCTCTGCACACCGACGGCTACCATAAC
CTCCTCTGCCAGGTCGTCGGCGCAAAATACATCCGCCTGTATCCTCCCGATGCCACGCCCTTTATGCGGCCCCGT
GGCTCTGAGCTCGGCGTCGACATGAGCAATACCAGCTGTATCGATCTGGGCGTCCTCGAGGGCTGGGATCGCCCG
CCTGATGATTACCATGAGCACGATCCGTCGCTTCTGCAGGGCGTTGACTACAGAGAGTGCATCTTGCAGCCGGGT
GATACCTTGCTGATTCCCATTGGATGGTGGCACTACGTCCGGAGCCTGAGCATCAGCTTCAGCCTCAGCTTCTGG
TGGAACTAG
Gene >Ophun1|3158
ATGCGTGCCAACTTCCTACTCGCCTTGCTGCCGCTGAGCACCGCAAACATCCACGCCTCCCCCGGCCATCCAAGC
AAAGTAACCAAGCTGACGTGCGGGTCAATGAAGGACACGACGCTGCCCCAGTTCCTCAACTACACCGTCCTCGAC
GTCACCAAGTACAACTCGGATAAACCGTGTGTGACGTGGGAATGCGTCAGGGTGTTGATGGAAACCTTCCCAGAC
GACTTTATAGACGCCATGGACTCGATAGCCGGTAAAAAGAAACATCGGGTGGTCAATGACATCGTGGCAGACCTC
CGCTTCGTCAGTCCCCATCGTTACCTCGAGTTCATCGCCTGGGTTCTCGAGTCCGGAGGCCGTCGGCGGAGGGTA
TGCTGGCTCGAAGACGACGTCGACTACTTCCCCTACTATCGAGACTCCCTCGGAGCCCTGACAGCCTACCTGATC
GACCCCGACCTCAGCGACGACAGGATGTACCGCCGATTCGTCGCCCTGACGCCAGGCCCGCTGCAACCCTCCCTG
ACAGCCTGCTTCCAAGGAGACGAGAGCACCTACCAGCAAATCAAGCTGTACCACAGCGAGCTCCGAGCCCCCAGC
AGCCTACGCTTCCTCCCCCGCTTCAAGAGCTACGACGACATCCGGTGGCAGACGAGCCAGTGGAGCGGCCTCCTC
GGACGGCTGCTGTACGAGGCGACGCAGGAGGTGTACGCGTGTCCCGCGGTATGCGGATGCGAGGCGACGCTGGAG
GCTTCGCGGCCGATGCTGCCGAGGGATTATGAGCATTTCTGGCGGACGCTTTACTGGCTCATGGTGACGGAGAAG
CCGTTTTGTCTGACCATGGGGACGACGAGTCGTAAGAACGTCCTGTTTAGCAATTGGATTGCCGCTGGCGGAGGT
AAGATGGTTGGAAAGTGTCGAAAGATGGTGCCCCCGTTGATGCCACGTATAGAGAAAAAACATTAAAGAATCGAG
ACGGGGAGGAAAAGGAGTGTGGGATGAGGGCATGGGGGTTGAGAGGAGGTGGATTATGGTGATTGCTGACTGGGA
GGCGACGGAACAGAGTCCAACTATGCATAGAACTCTCCTTGCAAGAATGTACCGCTCATTGGTAATGAATAGATA
CTTTTCACTTTGTATGTGAGAAGACGCATCTCAACTGGGAGTCTGATCTCTGAATATCGACGCTCGCTGAACAAT
GACGTAACCAGCAGCCTGACGTAAGCCAACTCCAGCTCTTTTCAACTCGACTCCTCACCACACGCCTCAACATCC
CAACAACCTCTCATCTCAATCCTCCAAGCCCTCATGCATCCCAACACCCTCCTCCCACGATACAAAACCGCCGTC
CAATCCATCGCTAATGCCCACCCCCCCGAAACCCACCCAACCAAAGCCATGACCCTCCTCCTCGCCCGCCAAGCC
AACCTCATCACATCCCCAGCCCCCAACACAAAGCTCCTCCGCCGCCGGCTCCAAGATGTGGCGTCGGTGGCGCTG
AGCAGGCTGTACGCCTACCGATACGATGCCGTGCCGCGGTTCTGGCGGTGTTTGTATACGGATGCCCTGGTGCTG
TGTGCTTGTGAGCGGGTGCTGGGCTGTGATGGGGGACAGTTGGATTTTGTGGTTGAGATGCTTGATCGTGTGCTT
GTTACTACGGGAGGGGTGAGCGACTGTCTAGGCGATGAATGGGTTGAGATGACGATGAGAATGCTTCAAGAAGCG
TACGAGGCGGATAACCAATACACAACTCCGACAATAACCCCTTTCACCTCTCACGAACCGAAACCACGCCCCCCC
CTCTCCCCCGAAAAGACCTGCCCTCGCCATCAAGACTGGTCCCTACACCGCTTCGAACAATACATCAACACAAGC
AACGAACCCATCATCTTCACCGACCTCATCAACAACTGGCCCGCCCTCACGAACCACCCGTGGAATCAACCAGAC
TACCTCCTCTCCCAAACACTCGGCGGCCGACGCCTCGTCCCCATCGAGCTGGGCCGCAGCTACGTCGATCAAGGA
TGGGGCCAGGAGTTGATGCCCTTTTCCCGCTTCTTGGCTGAGCATGTTGTTCAACAGACCGAGACGACGGGCTAC
CTCGCGCAGCATGATCTCTTCCGCCAGATCCCCTCGTTACGCCGCGACGTCACCATCCCGGACTACTGCTGGGCC
TCTGTCCCTCCTCATCCTCTCGATCCAAGCCAAGACCAGGCCACGCTCGACGTGCCCCAGCTCAACGCCTGGTTC
GGTCCGGCCGGTACCATCACGCCTCTGCACACCGACGGCTACCATAACCTCCTCTGCCAGGTCGTCGGCGCAAAA
TACATCCGCCTGTATCCTCCCGATGCCACGCCCTTTATGCGGCCCCGTGGCTCTGAGCTCGGCGTCGACATGAGC
AATACCAGCTGTATCGATCTGGGCGTCCTCGAGGGCTGGGATCGCCCGCCTGATGATTACCATGAGCACGATCCG
TCGCTTCTGCAGGGCGTTGACTACAGAGAGTGCATCTTGCAGCCGGGTGATACCTTGCTGATTCCCATTGGATGG
TGGCACTACGTCCGGAGCCTGAGCATCAGCTTCAGCCTCAGCTTCTGGTGGAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail