Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3151
Gene name
LocationContig_280:1977..7199
Strand-
Gene length (bp)5222
Transcript length (bp)3945
Coding sequence length (bp)3945
Protein length (aa) 1315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08719 NADAR NADAR domain 3.6E-46 7 192
PF16016 VASt VAD1 Analog of StAR-related lipid transfer domain 5.9E-35 962 1107
PF02893 GRAM GRAM domain 1.0E-21 713 820

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 684 1208 2.0E-76
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 699 1120 7.0E-70
sp|P43560|LAM5_YEAST Membrane-anchored lipid-binding protein LAM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM5 PE=1 SV=2 701 1110 3.0E-48
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 699 816 1.0E-31
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 941 1308 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42976|YGZ7_SCHPO Uncharacterized membrane protein C20F10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC20F10.07 PE=1 SV=1 684 1208 2.0E-76
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 699 1120 7.0E-70
sp|P43560|LAM5_YEAST Membrane-anchored lipid-binding protein LAM5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM5 PE=1 SV=2 701 1110 3.0E-48
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 699 816 1.0E-31
sp|P38800|LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM4 PE=1 SV=1 941 1308 1.0E-31
sp|Q80TI0|GRM1B_MOUSE GRAM domain-containing protein 1B OS=Mus musculus GN=Gramd1b PE=1 SV=2 637 1147 3.0E-31
sp|Q3KR37|GRM1B_HUMAN GRAM domain-containing protein 1B OS=Homo sapiens GN=GRAMD1B PE=1 SV=1 637 1144 6.0E-31
sp|Q96CP6|GRM1A_HUMAN GRAM domain-containing protein 1A OS=Homo sapiens GN=GRAMD1A PE=1 SV=2 708 1139 5.0E-30
sp|Q3KR56|GRM1A_RAT GRAM domain-containing protein 1A OS=Rattus norvegicus GN=Gramd1a PE=2 SV=2 638 1139 2.0E-28
sp|Q06681|YSP2_YEAST Membrane-anchored lipid-binding protein YSP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YSP2 PE=1 SV=1 940 1302 9.0E-28
sp|Q8VEF1|GRM1A_MOUSE GRAM domain-containing protein 1A OS=Mus musculus GN=Gramd1a PE=1 SV=2 708 1134 2.0E-27
sp|Q5UR67|RIBX_MIMIV N-glycosidase R617 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R617 PE=3 SV=1 58 189 8.0E-24
sp|Q8IYS0|GRM1C_HUMAN GRAM domain-containing protein 1C OS=Homo sapiens GN=GRAMD1C PE=1 SV=2 703 817 5.0E-20
sp|Q5RC33|GRM1C_PONAB GRAM domain-containing protein 1C OS=Pongo abelii GN=GRAMD1C PE=2 SV=1 703 817 5.0E-20
sp|Q96HH9|GRAM3_HUMAN GRAM domain-containing protein 3 OS=Homo sapiens GN=GRAMD3 PE=1 SV=1 709 820 4.0E-19
sp|Q5R8N8|GRAM3_PONAB GRAM domain-containing protein 3 OS=Pongo abelii GN=GRAMD3 PE=2 SV=1 709 846 5.0E-19
sp|Q6PEM6|GRAM3_MOUSE GRAM domain-containing protein 3 OS=Mus musculus GN=Gramd3 PE=1 SV=2 709 846 1.0E-18
sp|Q5FVG8|GRAM3_RAT GRAM domain-containing protein 3 OS=Rattus norvegicus GN=Gramd3 PE=1 SV=1 709 846 2.0E-18
sp|Q8IUY3|GRAM2_HUMAN GRAM domain-containing protein 2 OS=Homo sapiens GN=GRAMD2 PE=2 SV=2 705 834 2.0E-17
sp|Q08001|LAM6_YEAST Membrane-anchored lipid-binding protein LAM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM6 PE=1 SV=1 705 816 1.0E-15
sp|F4HVW5|VAD1_ARATH Protein VASCULAR ASSOCIATED DEATH 1, chloroplastic OS=Arabidopsis thaliana GN=VAD1 PE=1 SV=1 710 816 1.0E-15
sp|Q3V3G7|GRAM2_MOUSE GRAM domain-containing protein 2 OS=Mus musculus GN=Gramd2 PE=2 SV=1 709 828 7.0E-15
sp|Q08001|LAM6_YEAST Membrane-anchored lipid-binding protein LAM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAM6 PE=1 SV=1 1013 1115 2.0E-14
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 714 812 4.0E-08
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 714 812 1.0E-07
sp|Q54HC6|ARKA_DICDI Ankyrin repeat-containing protein kinase A OS=Dictyostelium discoideum GN=arkA PE=1 SV=1 712 810 1.0E-07
sp|B2J4E5|RIBX_NOSP7 N-glycosidase Npun_R5314 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R5314 PE=1 SV=1 61 194 6.0E-07
sp|Q5B4C9|ATG26_EMENI Sterol 3-beta-glucosyltransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg26 PE=3 SV=1 710 859 2.0E-06
sp|A7KAN4|ATG26_PENRW Sterol 3-beta-glucosyltransferase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg26 PE=3 SV=1 720 883 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 1189 1211 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3151
MPSRTVYFYSKGDTACFSQFHQNKFRAPLPTRTSITDPSSTLSHSASTPSPTPTQAAEFHHFAFAEQYMMYSKAV
LFEDTASATAILNANTPGRCKQLGRAVRGFDEAVWDLHKVSIVEEGNWWKFTQGLGAEGAAIRAQLLATGERELV
EASPRDRVWGIGFNEASAEGNRALWGQNLLGKVLDKTRQRIREIEWLEKPFQAIPLSFYSQLEWRTSFRSHPARL
TMDANGLGKLLPKALSSVKRKTRRNKPVVDDDAKRDSTDADLLPSRADSVDDHGRDQASVEDRHDDDDDDEHDVD
QRQRPASDTTPPTARPAPISAHPSQIGYLTTSSPVVQANHLDSQLSSSQPTVSSPRHSRPGSRDEVSPRTAASDD
DAPSRQLHLDTRQSRAPSAPTTPLIVSTPPTPVESAVAVGGGSSSTDKSKATTTTTTTDGVGADPNPHGSGSNQS
MSAPGRNKSSSAFSTIVPSKLSNTVLPSPIAENGPSTQTGGGGFFSSVLNAAQSAASTLSSNIPGGANKSRSSLA
RPQTSPSPARTETEPSVQSQPSSEPSMDSKKESAVQTLGSGDLSLSQLGIPEPAGPTAPPPAAAAAKLSEPVDLR
FRSDSAPADPQTRHQESFHEDSSRPHSLAEATVGEPSPSHPDPDGKTSIVRASSTRSTAKPRKKRRSSVNTGSTR
ATAAAAMAAQGSAIQPSTSFAAPKLTGFAIASKKRNRDFHTLFRSVPDDDYLIEDYSCALHREILAHGRLYVSEG
HLCFSSNILGWTTMLVMSFDEIVSVEKRSTALIFKNGLMISTLHAKHIFASFTGRDATYDLIINIWKLGHPTLKS
TLNGVRLDGTGGDKTEKVDEPLQERGTRAASESDEDSDDDDEDDDEEDDDDDDDFYDEENEYAADTQATELTSPD
AETEKSTGRKVSAMTTSAGGAVDASREAPTSPGGPADFPGPTTHAPTDCGDSATHYDKVVGDEVIAAPLGQVYNL
VFGPGSVDWMSKWLTSDQKCFDLQMENKTGLGSDHRIRNYTYIKPLNASIGPKQTKCIVAEAVDSFDIEKAINLN
VTTQTPDVPSGNVFSVKTKYCLSWAENNGTRIQVNCTTEWSGKSWLKGPIEKGVVDGQMQYCKDLFAALRAATAR
ARAGAAAHGPGKARKKAKKNKAQQAADGGAERNGGSKTTKKSDWGPLEPVRGLLEPCVEMAGPVLTGNVMYGLLV
GLLVAMWFGYGSVPSKSAGRYGPDLLYSPGRLAAYDEMWRREESELWEWLDERVGLDRLGSAKAEKRRQSFEDKL
RDTHMDEREMEEAIRVTEEKLKVLREVADKGGRGGKVEL*
Coding >Ophun1|3151
ATGCCTTCCCGTACGGTCTACTTCTACTCCAAAGGTGACACGGCCTGTTTCTCTCAGTTTCATCAGAACAAATTT
CGTGCTCCTCTTCCCACCCGCACATCCATCACCGATCCTTCCTCTACTCTCTCACACAGCGCCAGCACGCCGAGT
CCTACGCCCACGCAGGCTGCCGAATTCCACCACTTCGCCTTTGCGGAGCAATACATGATGTACAGTAAAGCGGTT
CTCTTCGAGGACACGGCTTCTGCTACTGCCATTCTCAACGCGAACACGCCGGGACGATGTAAGCAGCTCGGGCGC
GCGGTGCGTGGATTCGATGAAGCAGTGTGGGATCTGCACAAGGTGTCTATCGTCGAAGAGGGCAACTGGTGGAAG
TTTACCCAGGGCCTAGGAGCGGAGGGGGCGGCCATACGGGCACAATTACTAGCGACAGGGGAGCGAGAACTGGTC
GAAGCCAGCCCCAGAGACCGGGTGTGGGGAATCGGATTCAACGAAGCATCTGCCGAGGGGAATCGAGCACTATGG
GGTCAGAACTTGCTGGGCAAGGTGCTCGATAAGACGAGACAAAGGATAAGGGAAATCGAGTGGCTGGAGAAGCCA
TTCCAAGCCATTCCACTGAGCTTCTATTCTCAACTCGAGTGGAGAACGAGCTTCCGATCCCACCCTGCCCGCTTG
ACCATGGACGCGAATGGCCTGGGCAAGCTTCTGCCCAAGGCCCTCTCCTCCGTCAAGCGCAAGACGCGCCGGAAC
AAGCCGGTGGTCGACGACGACGCCAAGCGCGACAGCACCGACGCCGACTTGCTGCCGTCGAGGGCCGACAGCGTC
GATGACCATGGGCGTGACCAGGCCAGCGTCGAGGACCGCCACGACGACGACGACGACGACGAGCACGACGTCGAC
CAGCGACAGCGACCCGCTTCCGACACGACTCCACCCACAGCTCGTCCCGCCCCCATCTCGGCCCATCCGTCCCAA
ATCGGCTACCTGACAACGTCGTCCCCCGTGGTCCAGGCAAACCACCTCGACTCCCAGCTGTCGTCGAGCCAGCCT
ACAGTCAGCAGCCCCCGACATTCGAGACCCGGGAGCCGCGACGAAGTCTCCCCTCGAACCGCTGCCTCAGACGAC
GACGCCCCCTCGAGACAGCTGCATCTCGATACACGACAATCCCGAGCGCCATCCGCGCCCACCACGCCCTTGATT
GTGAGCACGCCACCGACCCCCGTCGAGTCTGCCGTCGCCGTCGGAGGGGGCTCTTCTTCGACCGACAAGTCAAAG
GCGACGACGACGACGACGACGACGGATGGTGTTGGCGCCGACCCCAATCCCCATGGCAGCGGTTCGAACCAGAGC
ATGAGCGCACCTGGGAGAAACAAATCGTCGTCTGCATTCTCCACCATCGTCCCAAGCAAATTGTCCAATACCGTC
CTCCCATCGCCAATCGCGGAAAACGGTCCAAGTACACAGACTGGTGGCGGCGGCTTCTTCTCCTCCGTCCTAAAC
GCCGCCCAGTCCGCGGCCAGCACTCTGAGCAGCAACATCCCTGGAGGCGCCAACAAGAGCCGCTCCAGCCTCGCC
AGGCCGCAGACCTCGCCGAGCCCCGCCCGTACCGAAACCGAGCCCTCGGTCCAATCCCAACCCTCGTCCGAACCG
AGCATGGATTCCAAAAAGGAGTCGGCCGTGCAGACGCTTGGCTCCGGCGACTTGAGCCTCAGCCAGCTCGGCATT
CCGGAGCCGGCCGGCCCCACAGCACCCCCGCCCGCCGCCGCTGCCGCCAAGCTGTCCGAGCCTGTCGATCTCAGA
TTCAGGTCTGACTCGGCCCCGGCCGACCCTCAGACGCGCCATCAAGAGTCGTTTCATGAAGACTCAAGTAGACCG
CACTCCCTCGCCGAGGCCACCGTCGGCGAACCCTCGCCCTCACACCCCGACCCCGATGGCAAGACTTCCATCGTG
CGGGCCTCTAGCACTCGAAGCACCGCCAAGCCGCGCAAGAAGCGGAGAAGTTCCGTCAATACGGGAAGCACCAGG
GCCACGGCGGCGGCGGCCATGGCAGCTCAGGGCTCTGCGATCCAGCCTTCCACCAGCTTTGCCGCTCCCAAGCTC
ACGGGGTTCGCCATCGCCAGCAAGAAACGGAACCGCGATTTCCATACCCTGTTCAGGAGCGTGCCCGATGATGAC
TACCTCATCGAGGACTACAGCTGTGCCCTGCACAGGGAGATACTCGCCCACGGCCGGCTCTACGTTTCCGAGGGT
CATCTGTGCTTCAGCAGCAACATCCTCGGCTGGACCACCATGTTGGTCATGAGCTTCGACGAGATAGTGTCCGTC
GAGAAGCGAAGCACGGCATTGATCTTCAAAAACGGGCTCATGATCTCGACGCTGCACGCCAAGCACATCTTTGCC
AGCTTCACCGGTCGAGACGCCACCTACGACCTCATCATCAATATCTGGAAGCTCGGCCATCCGACCCTCAAGAGC
ACCCTCAACGGCGTCAGACTCGACGGCACGGGGGGCGACAAGACGGAAAAGGTCGACGAGCCGCTGCAGGAGCGC
GGGACGCGGGCGGCCTCGGAGTCGGACGAAGACAGCGATGACGACGACGAAGACGATGACGAGGAAGATGATGAT
GATGACGACGACTTTTACGACGAGGAAAACGAGTACGCTGCCGACACGCAGGCTACGGAACTGACGAGCCCGGAC
GCCGAAACGGAAAAGTCTACGGGCCGCAAGGTGTCGGCCATGACGACCTCGGCGGGCGGTGCCGTCGATGCTTCG
AGGGAGGCGCCGACGTCACCGGGCGGACCGGCCGACTTTCCGGGGCCGACGACGCACGCGCCTACCGACTGCGGT
GACTCGGCCACTCACTACGACAAGGTGGTGGGAGACGAGGTGATCGCGGCGCCACTCGGCCAGGTGTACAACCTC
GTCTTCGGCCCGGGCTCGGTCGACTGGATGTCCAAGTGGTTGACGAGCGACCAAAAGTGCTTCGATCTGCAGATG
GAGAACAAGACGGGCCTGGGTTCGGACCACCGCATCCGCAACTACACGTACATCAAGCCGCTCAATGCCTCGATC
GGTCCCAAGCAGACCAAGTGCATCGTTGCCGAGGCGGTCGATAGTTTTGACATTGAAAAGGCCATCAACCTCAAC
GTGACGACGCAGACGCCCGACGTGCCTAGCGGAAACGTCTTTTCCGTCAAGACCAAGTACTGCCTATCGTGGGCG
GAGAATAACGGAACGCGGATTCAAGTCAACTGCACGACGGAATGGTCGGGCAAGAGTTGGCTCAAGGGACCGATC
GAAAAGGGCGTCGTCGATGGACAGATGCAGTACTGCAAGGATCTCTTCGCGGCGCTCCGAGCGGCGACGGCTCGG
GCGCGGGCGGGCGCCGCGGCCCACGGACCGGGCAAGGCTCGGAAGAAGGCCAAGAAGAACAAGGCGCAACAGGCG
GCCGATGGCGGAGCCGAGAGGAACGGCGGATCCAAGACGACCAAGAAGAGTGATTGGGGTCCTTTGGAGCCGGTC
CGAGGCCTTCTGGAACCGTGCGTGGAGATGGCCGGGCCGGTGCTGACGGGTAACGTCATGTACGGGCTACTTGTC
GGCCTGCTGGTGGCCATGTGGTTCGGCTACGGATCGGTACCGAGCAAGAGCGCCGGGCGGTACGGGCCCGATTTG
CTATACAGCCCCGGGCGACTGGCGGCCTACGACGAGATGTGGCGGCGTGAGGAGAGCGAGCTGTGGGAGTGGCTA
GACGAGCGCGTTGGGCTGGACCGGCTCGGGTCGGCCAAGGCGGAGAAGAGGCGGCAGAGCTTCGAGGACAAGCTG
CGGGACACGCACATGGACGAGCGGGAGATGGAGGAGGCGATCCGGGTGACGGAGGAGAAGCTCAAGGTGCTACGC
GAGGTTGCTGACAAGGGCGGACGGGGGGGCAAGGTCGAGTTATAG
Transcript >Ophun1|3151
ATGCCTTCCCGTACGGTCTACTTCTACTCCAAAGGTGACACGGCCTGTTTCTCTCAGTTTCATCAGAACAAATTT
CGTGCTCCTCTTCCCACCCGCACATCCATCACCGATCCTTCCTCTACTCTCTCACACAGCGCCAGCACGCCGAGT
CCTACGCCCACGCAGGCTGCCGAATTCCACCACTTCGCCTTTGCGGAGCAATACATGATGTACAGTAAAGCGGTT
CTCTTCGAGGACACGGCTTCTGCTACTGCCATTCTCAACGCGAACACGCCGGGACGATGTAAGCAGCTCGGGCGC
GCGGTGCGTGGATTCGATGAAGCAGTGTGGGATCTGCACAAGGTGTCTATCGTCGAAGAGGGCAACTGGTGGAAG
TTTACCCAGGGCCTAGGAGCGGAGGGGGCGGCCATACGGGCACAATTACTAGCGACAGGGGAGCGAGAACTGGTC
GAAGCCAGCCCCAGAGACCGGGTGTGGGGAATCGGATTCAACGAAGCATCTGCCGAGGGGAATCGAGCACTATGG
GGTCAGAACTTGCTGGGCAAGGTGCTCGATAAGACGAGACAAAGGATAAGGGAAATCGAGTGGCTGGAGAAGCCA
TTCCAAGCCATTCCACTGAGCTTCTATTCTCAACTCGAGTGGAGAACGAGCTTCCGATCCCACCCTGCCCGCTTG
ACCATGGACGCGAATGGCCTGGGCAAGCTTCTGCCCAAGGCCCTCTCCTCCGTCAAGCGCAAGACGCGCCGGAAC
AAGCCGGTGGTCGACGACGACGCCAAGCGCGACAGCACCGACGCCGACTTGCTGCCGTCGAGGGCCGACAGCGTC
GATGACCATGGGCGTGACCAGGCCAGCGTCGAGGACCGCCACGACGACGACGACGACGACGAGCACGACGTCGAC
CAGCGACAGCGACCCGCTTCCGACACGACTCCACCCACAGCTCGTCCCGCCCCCATCTCGGCCCATCCGTCCCAA
ATCGGCTACCTGACAACGTCGTCCCCCGTGGTCCAGGCAAACCACCTCGACTCCCAGCTGTCGTCGAGCCAGCCT
ACAGTCAGCAGCCCCCGACATTCGAGACCCGGGAGCCGCGACGAAGTCTCCCCTCGAACCGCTGCCTCAGACGAC
GACGCCCCCTCGAGACAGCTGCATCTCGATACACGACAATCCCGAGCGCCATCCGCGCCCACCACGCCCTTGATT
GTGAGCACGCCACCGACCCCCGTCGAGTCTGCCGTCGCCGTCGGAGGGGGCTCTTCTTCGACCGACAAGTCAAAG
GCGACGACGACGACGACGACGACGGATGGTGTTGGCGCCGACCCCAATCCCCATGGCAGCGGTTCGAACCAGAGC
ATGAGCGCACCTGGGAGAAACAAATCGTCGTCTGCATTCTCCACCATCGTCCCAAGCAAATTGTCCAATACCGTC
CTCCCATCGCCAATCGCGGAAAACGGTCCAAGTACACAGACTGGTGGCGGCGGCTTCTTCTCCTCCGTCCTAAAC
GCCGCCCAGTCCGCGGCCAGCACTCTGAGCAGCAACATCCCTGGAGGCGCCAACAAGAGCCGCTCCAGCCTCGCC
AGGCCGCAGACCTCGCCGAGCCCCGCCCGTACCGAAACCGAGCCCTCGGTCCAATCCCAACCCTCGTCCGAACCG
AGCATGGATTCCAAAAAGGAGTCGGCCGTGCAGACGCTTGGCTCCGGCGACTTGAGCCTCAGCCAGCTCGGCATT
CCGGAGCCGGCCGGCCCCACAGCACCCCCGCCCGCCGCCGCTGCCGCCAAGCTGTCCGAGCCTGTCGATCTCAGA
TTCAGGTCTGACTCGGCCCCGGCCGACCCTCAGACGCGCCATCAAGAGTCGTTTCATGAAGACTCAAGTAGACCG
CACTCCCTCGCCGAGGCCACCGTCGGCGAACCCTCGCCCTCACACCCCGACCCCGATGGCAAGACTTCCATCGTG
CGGGCCTCTAGCACTCGAAGCACCGCCAAGCCGCGCAAGAAGCGGAGAAGTTCCGTCAATACGGGAAGCACCAGG
GCCACGGCGGCGGCGGCCATGGCAGCTCAGGGCTCTGCGATCCAGCCTTCCACCAGCTTTGCCGCTCCCAAGCTC
ACGGGGTTCGCCATCGCCAGCAAGAAACGGAACCGCGATTTCCATACCCTGTTCAGGAGCGTGCCCGATGATGAC
TACCTCATCGAGGACTACAGCTGTGCCCTGCACAGGGAGATACTCGCCCACGGCCGGCTCTACGTTTCCGAGGGT
CATCTGTGCTTCAGCAGCAACATCCTCGGCTGGACCACCATGTTGGTCATGAGCTTCGACGAGATAGTGTCCGTC
GAGAAGCGAAGCACGGCATTGATCTTCAAAAACGGGCTCATGATCTCGACGCTGCACGCCAAGCACATCTTTGCC
AGCTTCACCGGTCGAGACGCCACCTACGACCTCATCATCAATATCTGGAAGCTCGGCCATCCGACCCTCAAGAGC
ACCCTCAACGGCGTCAGACTCGACGGCACGGGGGGCGACAAGACGGAAAAGGTCGACGAGCCGCTGCAGGAGCGC
GGGACGCGGGCGGCCTCGGAGTCGGACGAAGACAGCGATGACGACGACGAAGACGATGACGAGGAAGATGATGAT
GATGACGACGACTTTTACGACGAGGAAAACGAGTACGCTGCCGACACGCAGGCTACGGAACTGACGAGCCCGGAC
GCCGAAACGGAAAAGTCTACGGGCCGCAAGGTGTCGGCCATGACGACCTCGGCGGGCGGTGCCGTCGATGCTTCG
AGGGAGGCGCCGACGTCACCGGGCGGACCGGCCGACTTTCCGGGGCCGACGACGCACGCGCCTACCGACTGCGGT
GACTCGGCCACTCACTACGACAAGGTGGTGGGAGACGAGGTGATCGCGGCGCCACTCGGCCAGGTGTACAACCTC
GTCTTCGGCCCGGGCTCGGTCGACTGGATGTCCAAGTGGTTGACGAGCGACCAAAAGTGCTTCGATCTGCAGATG
GAGAACAAGACGGGCCTGGGTTCGGACCACCGCATCCGCAACTACACGTACATCAAGCCGCTCAATGCCTCGATC
GGTCCCAAGCAGACCAAGTGCATCGTTGCCGAGGCGGTCGATAGTTTTGACATTGAAAAGGCCATCAACCTCAAC
GTGACGACGCAGACGCCCGACGTGCCTAGCGGAAACGTCTTTTCCGTCAAGACCAAGTACTGCCTATCGTGGGCG
GAGAATAACGGAACGCGGATTCAAGTCAACTGCACGACGGAATGGTCGGGCAAGAGTTGGCTCAAGGGACCGATC
GAAAAGGGCGTCGTCGATGGACAGATGCAGTACTGCAAGGATCTCTTCGCGGCGCTCCGAGCGGCGACGGCTCGG
GCGCGGGCGGGCGCCGCGGCCCACGGACCGGGCAAGGCTCGGAAGAAGGCCAAGAAGAACAAGGCGCAACAGGCG
GCCGATGGCGGAGCCGAGAGGAACGGCGGATCCAAGACGACCAAGAAGAGTGATTGGGGTCCTTTGGAGCCGGTC
CGAGGCCTTCTGGAACCGTGCGTGGAGATGGCCGGGCCGGTGCTGACGGGTAACGTCATGTACGGGCTACTTGTC
GGCCTGCTGGTGGCCATGTGGTTCGGCTACGGATCGGTACCGAGCAAGAGCGCCGGGCGGTACGGGCCCGATTTG
CTATACAGCCCCGGGCGACTGGCGGCCTACGACGAGATGTGGCGGCGTGAGGAGAGCGAGCTGTGGGAGTGGCTA
GACGAGCGCGTTGGGCTGGACCGGCTCGGGTCGGCCAAGGCGGAGAAGAGGCGGCAGAGCTTCGAGGACAAGCTG
CGGGACACGCACATGGACGAGCGGGAGATGGAGGAGGCGATCCGGGTGACGGAGGAGAAGCTCAAGGTGCTACGC
GAGGTTGCTGACAAGGGCGGACGGGGGGGCAAGGTCGAGTTATAG
Gene >Ophun1|3151
ATGCCTTCCCGTACGGTCTACTTCTACTCCAAAGGTGACACGGCCTGTTTCTCTCAGTTTCATCAGAACAAATTT
CGTGCTCCTCTTCCCACCCGCACATCCATCACCGATCCTTCCTCTACTCTCTCACACAGCGCCAGCACGCCGAGT
CCTACGCCCACGCAGGCTGCCGAATTCCACCACTTCGCCTTTGCGGAGCAATACATGATGTACAGTAAAGCGGTT
CTCTTCGAGGACACGGCTTCTGCTACTGCCATTCTCAACGCGAACACGCCGGGACGATGTAAGCAGCTCGGGCGC
GCGGTGCGTGGATTCGATGAAGCAGTGTGGGATCTGCACAAGGTGTCTATCGTCGAAGAGGGCAACTGGTGGAAG
TTTACCCAGGGCCTAGGAGCGGAGGGGGCGGCCATACGGGCACAATTACTAGCGACAGGGGAGCGAGAACTGGTC
GAAGCCAGCCCCAGAGACCGGGTGTGGGGAATCGGATTCAACGAAGCATCTGCCGAGGGGAATCGAGCACTATGG
GGTCAGAACTTGCTGGGCAAGGTGCTCGATAAGACGAGACAAAGGATAAGGGAAATCGAGGTGAAGAATAAAGGT
TAGGTAGAGATTGGGGGGAGCTGATCGGTGACTTACGCATGCACATGGGGTATAGAATCCCTGTCTCTCACGCCC
TTCCCTCCCAGTGCTTACGGTCCAGCCCGTAAGACACCTGCATGTATCTCCAGTGACGTCGTCGCGGGTTTGAGC
TTCACAATGCATCGATGCATGGATGCTTGCTTTGTTGGCTTCCCCGCGCCGGGCAGTGGCTGGAGAAGCCATTCC
AAGCCATTCCACTGAGCTTCTATTCTCAACTCGAGTGGAGAACGAGGTTAGGAGCTATCTTTTAGACGGACCAAT
GGCTTCGGACGGCTTCTCTGCAGGCAAGGAGTATCGCATGGCGGCAGCCGGACTGGGCTAGAGAGTCAGCCTAGA
GGAGGCGGGCAGGCACGTTAGCAAGTCAGGCGGGTGCGCTTGCTAGAGTCGATGCGTGCGCACGTCACCGTCTGT
GGCAGCGGCAGGCAGTGGGATTTGCCACCAGCATGGATGCAGCGGGTTGAAGATGGACAGTGGCACTCCAAAGTA
TGTACATCAGAATCTGTCCATTTATTATCCCGGCGGCTCCAGGTCAGTTGAGACTTGAGGCAGAGAGATTCCATA
GAACGAACAGGTATATCCGTACATGGTATTCGTACTTCGTACTTTTTGAGGCAGGAATCGGTGCCGGCAGCTGCG
ACCTCAGCTTCCACATGACGAATGATGAATCTGATTCGCCTTACCTAACGACGTTGCTCGATCGGTGGGCGTACG
TCAGCCCCGTGTCTTCCCTGGATGCTGCCCATGTCGTCCAGGCCATGTCCCATGTCGTCACCTGCGCAGCCTCTG
CTCTCCTCGACTCGATTCATACCTACCTCGTACTACAGATCGACGGCGCCTACGAATAATACTTGAATGCCTGCG
CCTGCACCTGCACGACCGTCGCACCATCCAGAGAACATGCAGCGCGCCTAGATGACGACAGAAAAGGACGCAGCC
GCGCTGCCCATGTATGCAAAACTCTGCCCGTTTTGTCTGGTCCCAGCTTCCGATCCCACCCTGCCCGCTTGACCA
TGGACGCGAATGGCCTGGGCAAGCTTCTGCCCAAGGCCCTCTCCTCCGTCAAGCGCAAGACGCGCCGGAACAAGC
CGGTGGTCGACGACGACGCCAAGCGCGACAGCACCGACGCCGACTTGCTGCCGTCGAGGGCCGACAGCGTCGATG
ACCATGGGCGTGACCAGGCCAGCGTCGAGGACCGCCACGACGACGACGACGACGACGAGCACGACGTCGACCAGC
GGTGAGTCGGTCGTCTCGTGGCCTGTCTGACATGTTTACTATTCCGAGCCGGCCTCCTTTCTTCCTACCAACGTC
TACCTACCAAAACTTACCCATGAACCTTGCTTTTTCCCCCCTCCCCAGACCCAAGTTGCTGCTCTGCTCCCTTGA
ATTGCCCGTTTCCTTCTCTCTTCCCAGTTCCCACCTTTTAGCCTGGCCTCTCTCTCTCTCCCTAGCTAACCCAAA
CCTGGTCAGACAGCGACCCGCTTCCGACACGACTCCACCCACAGCTCGTCCCGCCCCCATCTCGGCCCATCCGTC
CCAAATCGGCTACCTGACAACGTCGTCCCCCGTGGTCCAGGCAAACCACCTCGACTCCCAGCTGTCGTCGAGCCA
GCCTACAGTCAGCAGCCCCCGACATTCGAGACCCGGGAGCCGCGACGAAGTCTCCCCTCGAACCGCTGCCTCAGA
CGACGACGCCCCCTCGAGACAGCTGCATCTCGATACACGACAATCCCGAGCGCCATCCGCGCCCACCACGCCCTT
GATTGTGAGCACGCCACCGACCCCCGTCGAGTCTGCCGTCGCCGTCGGAGGGGGCTCTTCTTCGACCGACAAGTC
AAAGGCGACGACGACGACGACGACGACGGATGGTGTTGGCGCCGACCCCAATCCCCATGGCAGCGGTTCGAACCA
GAGCATGAGCGCACCTGGGAGAAACAAATCGTCGTCTGCATTCTCCACCATCGTCCCAAGCAAATTGTCCAATAC
CGTCCTCCCATCGCCAATCGCGGAAAACGGTCCAAGTACACAGACTGGTGGCGGCGGCTTCTTCTCCTCCGTCCT
AAACGCCGCCCAGTCCGCGGCCAGCACTCTGAGCAGCAACATCCCTGGAGGCGCCAACAAGAGCCGCTCCAGCCT
CGCCAGGCCGCAGACCTCGCCGAGCCCCGCCCGTACCGAAACCGAGCCCTCGGTCCAATCCCAACCCTCGTCCGA
ACCGAGCATGGATTCCAAAAAGGAGTCGGCCGTGCAGACGCTTGGCTCCGGCGACTTGAGCCTCAGCCAGCTCGG
CATTCCGGAGCCGGCCGGCCCCACAGCACCCCCGCCCGCCGCCGCTGCCGCCAAGCTGTCCGAGCCTGTCGATCT
CAGATTCAGGTCTGACTCGGCCCCGGCCGACCCTCAGACGCGCCATCAAGAGTCGTTTCATGAAGACTCAAGTAG
ACCGCACTCCCTCGCCGAGGCCACCGTCGGCGAACCCTCGCCCTCACACCCCGACCCCGATGGCAAGACTTCCAT
CGTGCGGGCCTCTAGCACTCGAAGCACCGCCAAGCCGCGCAAGAAGCGGAGAAGTTCCGTCAATACGGGAAGCAC
CAGGGCCACGGCGGCGGCGGCCATGGCAGCTCAGGGCTCTGCGATCCAGCCTTCCACCAGCTTTGCCGCTCCCAA
GCTCACGGGGTTCGCCATCGCCAGCAAGAAACGGAACCGCGATTTCCATACCCTGTTCAGGAGCGTGCCCGATGA
TGACTACCTCATCGAGGACTACAGCTGTGCCCTGCACAGGGAGATACTCGCCCACGGCCGGCTCTACGTTTCCGA
GGGTCATCTGTGCTTCAGCAGCAACATCCTCGGCTGGACCACCATGTTGGTCATGAGCTTCGACGAGATAGTGTC
CGTCGAGAAGCGAAGCACGGCATTGATCTTCAAAAACGGGCTCATGATCTCGACGCTGCACGCCAAGCACATCTT
TGCCAGCTTCACCGGTCGAGACGCCACCTACGACCTCATCATCAATATCTGGAAGCTCGGCCATCCGACCCTCAA
GAGCACCCTCAACGGCGTCAGACTCGACGGCACGGGGGGCGACAAGACGGAAAAGGTCGACGAGCCGCTGCAGGA
GCGCGGGACGCGGGCGGCCTCGGAGTCGGACGAAGACAGCGATGACGACGACGAAGACGATGACGAGGAAGATGA
TGATGATGACGACGACTTTTACGACGAGGAAAACGAGTACGCTGCCGACACGCAGGCTACGGAACTGACGAGCCC
GGACGCCGAAACGGAAAAGTCTACGGGCCGCAAGGTGTCGGCCATGACGACCTCGGCGGGCGGTGCCGTCGATGC
TTCGAGGGAGGCGCCGACGTCACCGGGCGGACCGGCCGACTTTCCGGGGCCGACGACGCACGCGCCTACCGACTG
CGGTGACTCGGCCACTCACTACGACAAGGTGGTGGGAGACGAGGTGATCGCGGCGCCACTCGGCCAGGTGTACAA
CCTCGTCTTCGGCCCGGGCTCGGTCGACTGGATGTCCAAGTGGTTGACGAGCGACCAAAAGTGCTTCGATCTGCA
GATGGAGAACAAGACGGGCCTGGGTTCGGACCACCGCATCCGCAACTACACGTACATCAAGCCGCTCAATGCCTC
GATCGGTCCCAAGCAGACCAAGTGCATCGTTGCCGAGGCGGTCGATAGTTTTGACATTGAAAAGGCCATCAACCT
CAACGTGACGACGCAGACGCCCGACGTGCCTAGCGGAAACGTCTTTTCCGTCAAGACCAAGTACTGCCTATCGTG
GGCGGAGAATAACGGAACGCGGATTCAAGTCAACTGCACGACGGAATGGTCGGGCAAGAGTTGGCTCAAGGGTTA
GGCGACCTCTCCTTCTCCCCTTGTCGTTGTCAGGGCGGGTGGATGGCTAACACGAGACGGGGGCATCAGGACCGA
TCGAAAAGGGCGTCGTCGATGGACAGATGCAGTACTGCAAGGATCTCTTCGCGGCGCTCCGAGCGGCGACGGCTC
GGGCGCGGGCGGGCGCCGCGGCCCACGGACCGGGCAAGGCTCGGAAGAAGGCCAAGAAGAACAAGGCGCAACAGG
CGGCCGATGGCGGAGCCGAGAGGAACGGCGGATCCAAGACGACCAAGAAGAGTGATTGGGGTCCTTTGGAGCCGG
TCCGAGGCCTTCTGGAACCGTGCGTGGAGATGGCCGGGCCGGTGCTGACGGGTAACGTCATGTACGGGCTACTTG
TCGGCCTGCTGGTGGCCATGTGGTTCGGCTACGGATCGGTACCGAGCAAGAGCGCCGGGCGGTACGGGCCCGATT
TGCTATACAGCCCCGGGCGACTGGCGGCCTACGACGAGATGTGGCGGCGTGAGGAGAGCGAGCTGTGGGAGTGGC
TAGACGAGCGCGTTGGGCTGGACCGGCTCGGGTCGGCCAAGGCGGAGAAGAGGCGGCAGAGCTTCGAGGACAAGC
TGCGGGACACGCACATGGACGAGCGGGAGATGGAGGAGGCGATCCGGGTGACGGAGGAGAAGCTCAAGGTGCTAC
GCGAGGTTGCTGACAAGGGCGGACGGGGGGGCAAGGTCGAGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail