Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3149
Gene name
LocationContig_28:51531..53554
Strand-
Gene length (bp)2023
Transcript length (bp)1713
Coding sequence length (bp)1713
Protein length (aa) 571

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.1E-06 77 137

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 189 208 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3453
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|762
Ophiocordyceps australis map64 (Brazil) OphauB2|4383
Ophiocordyceps camponoti-floridani Ophcf2|06050
Ophiocordyceps camponoti-rufipedis Ophun1|3149 (this protein)
Ophiocordyceps kimflemingae Ophio5|2523
Ophiocordyceps subramaniannii Hirsu2|6581

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3149
MSLLGHPYSTVGDLALDTPWLLALSMIAASLHTRRIHDVLDLDSSAADADVMAHREADRPSQSSSSHVAQHSACA
NSCAATLASHADRFKVTVLEKSDVVGGQATSIPLDEQKYGAPWMNNGVQGGSKIFKHTFNFFHQQGFPAQEVQLQ
VAFGKGDAGFWTNVFPSKLVQRYEADVKKFGFFLKLIKWTMPVLGLVPISIMLRVLLFSKDFGDKMVYPLIALFL
GTGNQTPHVPSAIVERLFDDPNMKLWDYDPVTLLPNLPTMFTFDHLHAFYGAWKTDLEGKGVIFRNGTEVHEVLS
RTKDGVKLRVGDVASGSSTEETFDDVVFCVLADDALRILGRQATWREKLVLGGAAFYDDITVTHTDRAYFEKQYE
TAFKPELCAEPTSDSQKKQIAFAKGEGGSGSGGFQPMYYTFSYQQDPRLIEMSFNCSNYQHQLKKANEDAKGSRF
EPVYQTIFLNKKLKHLWTIDDIDESKVLKKNWWHQLGHRWQHYLRVVPGMMFINGRNRTSFAGSWTLVNMHELAC
VSGIAAAYRLGADYQHFDDFAQDFFAKYLLLSHGMIFSRQEKRRR*
Coding >Ophun1|3149
ATGTCTCTCCTCGGGCACCCTTACTCGACAGTCGGCGACCTGGCTCTGGACACGCCATGGCTATTAGCCCTGTCC
ATGATCGCGGCCTCCTTGCATACCAGACGAATCCATGACGTGCTCGACTTGGACAGCTCCGCGGCTGATGCCGAC
GTCATGGCCCATCGCGAGGCCGACAGACCGTCGCAGAGCTCCTCCTCTCACGTCGCACAACATTCTGCCTGTGCA
AACTCTTGCGCTGCGACGTTGGCCAGTCATGCCGATCGCTTCAAAGTAACCGTCTTGGAGAAGAGCGATGTTGTC
GGGGGACAGGCGACGTCCATCCCGCTCGACGAGCAAAAATACGGCGCGCCGTGGATGAATAACGGTGTCCAGGGA
GGATCCAAAATATTCAAGCACACCTTCAACTTCTTCCATCAGCAGGGCTTCCCGGCGCAGGAGGTTCAGTTACAG
GTTGCTTTTGGCAAAGGCGACGCCGGCTTCTGGACAAATGTCTTCCCCAGCAAGCTCGTCCAGCGCTACGAGGCC
GATGTCAAAAAGTTTGGCTTCTTTCTCAAGCTCATCAAATGGACTATGCCTGTCCTGGGCCTCGTGCCCATATCC
ATCATGCTGCGTGTCCTCCTCTTCAGCAAGGACTTTGGAGACAAGATGGTCTATCCTCTCATCGCCCTCTTCCTC
GGCACCGGCAACCAAACCCCTCACGTGCCTTCGGCCATTGTCGAACGTCTCTTTGACGATCCCAACATGAAGCTC
TGGGACTACGACCCCGTCACCTTGCTGCCAAACCTGCCCACCATGTTTACCTTTGACCACCTCCACGCCTTCTAC
GGCGCCTGGAAGACCGATCTGGAGGGCAAAGGGGTCATCTTTCGCAATGGCACAGAGGTTCATGAAGTCTTGTCG
AGGACCAAGGACGGGGTCAAGCTCCGGGTTGGAGACGTCGCCTCAGGCAGCTCTACAGAGGAGACTTTTGACGAT
GTCGTCTTCTGTGTGCTTGCCGATGATGCTCTCCGAATCCTGGGTCGCCAGGCAACATGGCGTGAAAAGCTGGTG
CTCGGCGGTGCCGCATTCTATGACGACATCACCGTCACTCATACCGATCGGGCTTATTTCGAAAAGCAATACGAG
ACAGCCTTCAAGCCCGAGTTGTGCGCGGAGCCGACGTCAGATTCTCAGAAGAAGCAGATTGCCTTTGCCAAAGGT
GAAGGAGGTTCAGGCTCAGGCGGCTTCCAGCCCATGTATTACACATTCTCTTACCAGCAGGACCCCCGTTTGATC
GAAATGTCGTTTAACTGTAGCAACTACCAACACCAGCTGAAGAAGGCCAACGAAGACGCCAAGGGTAGCAGGTTT
GAGCCCGTCTATCAGACCATCTTTCTCAACAAGAAGCTCAAACACTTGTGGACGATTGACGACATCGACGAGTCA
AAGGTCCTCAAGAAGAATTGGTGGCATCAGCTCGGTCACCGGTGGCAGCACTACCTCCGCGTCGTCCCGGGCATG
ATGTTCATCAATGGGAGAAACCGGACTTCCTTTGCCGGATCCTGGACGCTGGTGAACATGCACGAGCTGGCCTGC
GTCAGCGGCATCGCCGCCGCCTATCGCCTGGGGGCCGATTACCAACACTTTGACGACTTTGCCCAAGATTTCTTT
GCAAAATACCTCTTGCTGTCGCACGGCATGATCTTTTCCCGGCAGGAGAAGCGAAGGCGTTGA
Transcript >Ophun1|3149
ATGTCTCTCCTCGGGCACCCTTACTCGACAGTCGGCGACCTGGCTCTGGACACGCCATGGCTATTAGCCCTGTCC
ATGATCGCGGCCTCCTTGCATACCAGACGAATCCATGACGTGCTCGACTTGGACAGCTCCGCGGCTGATGCCGAC
GTCATGGCCCATCGCGAGGCCGACAGACCGTCGCAGAGCTCCTCCTCTCACGTCGCACAACATTCTGCCTGTGCA
AACTCTTGCGCTGCGACGTTGGCCAGTCATGCCGATCGCTTCAAAGTAACCGTCTTGGAGAAGAGCGATGTTGTC
GGGGGACAGGCGACGTCCATCCCGCTCGACGAGCAAAAATACGGCGCGCCGTGGATGAATAACGGTGTCCAGGGA
GGATCCAAAATATTCAAGCACACCTTCAACTTCTTCCATCAGCAGGGCTTCCCGGCGCAGGAGGTTCAGTTACAG
GTTGCTTTTGGCAAAGGCGACGCCGGCTTCTGGACAAATGTCTTCCCCAGCAAGCTCGTCCAGCGCTACGAGGCC
GATGTCAAAAAGTTTGGCTTCTTTCTCAAGCTCATCAAATGGACTATGCCTGTCCTGGGCCTCGTGCCCATATCC
ATCATGCTGCGTGTCCTCCTCTTCAGCAAGGACTTTGGAGACAAGATGGTCTATCCTCTCATCGCCCTCTTCCTC
GGCACCGGCAACCAAACCCCTCACGTGCCTTCGGCCATTGTCGAACGTCTCTTTGACGATCCCAACATGAAGCTC
TGGGACTACGACCCCGTCACCTTGCTGCCAAACCTGCCCACCATGTTTACCTTTGACCACCTCCACGCCTTCTAC
GGCGCCTGGAAGACCGATCTGGAGGGCAAAGGGGTCATCTTTCGCAATGGCACAGAGGTTCATGAAGTCTTGTCG
AGGACCAAGGACGGGGTCAAGCTCCGGGTTGGAGACGTCGCCTCAGGCAGCTCTACAGAGGAGACTTTTGACGAT
GTCGTCTTCTGTGTGCTTGCCGATGATGCTCTCCGAATCCTGGGTCGCCAGGCAACATGGCGTGAAAAGCTGGTG
CTCGGCGGTGCCGCATTCTATGACGACATCACCGTCACTCATACCGATCGGGCTTATTTCGAAAAGCAATACGAG
ACAGCCTTCAAGCCCGAGTTGTGCGCGGAGCCGACGTCAGATTCTCAGAAGAAGCAGATTGCCTTTGCCAAAGGT
GAAGGAGGTTCAGGCTCAGGCGGCTTCCAGCCCATGTATTACACATTCTCTTACCAGCAGGACCCCCGTTTGATC
GAAATGTCGTTTAACTGTAGCAACTACCAACACCAGCTGAAGAAGGCCAACGAAGACGCCAAGGGTAGCAGGTTT
GAGCCCGTCTATCAGACCATCTTTCTCAACAAGAAGCTCAAACACTTGTGGACGATTGACGACATCGACGAGTCA
AAGGTCCTCAAGAAGAATTGGTGGCATCAGCTCGGTCACCGGTGGCAGCACTACCTCCGCGTCGTCCCGGGCATG
ATGTTCATCAATGGGAGAAACCGGACTTCCTTTGCCGGATCCTGGACGCTGGTGAACATGCACGAGCTGGCCTGC
GTCAGCGGCATCGCCGCCGCCTATCGCCTGGGGGCCGATTACCAACACTTTGACGACTTTGCCCAAGATTTCTTT
GCAAAATACCTCTTGCTGTCGCACGGCATGATCTTTTCCCGGCAGGAGAAGCGAAGGCGTTGA
Gene >Ophun1|3149
ATGTCTCTCCTCGGGCACCCTTACTCGACAGTCGGCGACCTGGCTCTGGACACGCCATGGCTATTAGCCCTGTCC
ATGATCGCGGCCTCCTTGCATACCAGACGAATCCATGACGTGCTCGACTTGGACAGCTCCGCGGCTGATGCCGAC
GTCATGGCCCATCGCGAGGCCGACAGACCGTCGCAGAGCTCCTCCTCTCACGTCGCACAACATTCTGCCTGTGCA
AACGTTGGTCGCCAGCAGCAATGCCTCGCAAGCAGTCTGGGCGTGACGAAATGGATCCGCTTAACAGCAAGGCCA
AGCATGTCGTGATAGTCGGCGGAGGGGCCGCAGGCATGGTGGGATCCGACCACTCCACTCTCACAGGAACCCTCT
GTCGTCGTCCGACATCAACTGACCTACCTAACCTACAGTCTTGCGCTGCGACGTTGGCCAGTCATGCCGATCGCT
TCAAAGTAACCGTCTTGGAGAAGAGCGATGTTGTCGGGGGACAGGCGACGTCCATCCCGCTCGACGAGCAAAAAT
ACGGCGCGCCGTGGATGAATAACGGTGTCCAGGGAGGATCCAAAGTCAGTGCTCCCCTTCTTCAACCCTCTCCAG
CTCTATTCACGCTGCTGACGAGGCATACCGCAGATATTCAAGCACACCTTCAACTTCTTCCATCAGCAGGGCTTC
CCGGCGCAGGAGGTTCAGTTACAGGTTGCTTTTGGCAAAGGCGACGCCGGCTTCTGGACAAATGTCTTCCCCAGC
AAGCTCGTCCAGCGCTACGAGGCCGATGTCAAAAAGTTTGGCTTCTTTCTCAAGCTCATCAAATGGACTATGCCT
GTCCTGGGCCTCGTGCCCATATCCATCATGCTGCGTGTCCTCCTCTTCAGCAAGGACTTTGGAGACAAGATGGTC
TATCCTCTCATCGCCCTCTTCCTCGGCACCGGCAACCAAACCCCTCACGTGCCTTCGGCCATTGTCGAACGTCTC
TTTGACGATCCCAACATGAAGCTCTGGGACTACGACCCCGTCACCTTGCTGCCAAACCTGCCCACCATGTTTACC
TTTGACCACCTCCACGCCTTCTACGGCGCCTGGAAGACCGATCTGGAGGGCAAAGGGGTCATCTTTCGCAATGGC
ACAGAGGTTCATGAAGTCTTGTCGAGGACCAAGGACGGGGTCAAGCTCCGGGTTGGAGACGTCGCCTCAGGCAGC
TCTACAGAGGAGACTTTTGACGATGTCGTCTTCTGTGTGCTTGCCGATGATGCTCTCCGAATCCTGGGTCGCCAG
GCAACATGGCGTGAAAAGCTGGTGCTCGGCGGTGCCGCATTCTATGACGACATCACCGTCACTCATACCGATCGG
GCTTATTTCGAAAAGCAATACGAGACAGCCTTCAAGCCCGAGTTGTGCGCGGAGCCGACGTCAGATTCTCAGAAG
AAGCAGATTGCCTTTGCCAAAGGTGAAGGAGGTTCAGGCTCAGGCGGCTTCCAGCCCATGTATTACACATTCTCT
TACCAGCAGGACCCCCGTTTGATCGAAATGTCGTTTAACTGTAGCAACTACCAACACCAGCTGAAGAAGGCCAAC
GAAGACGCCAAGGGTAGCAGGTTTGAGCCCGTCTATCAGACCATCTTTCTCAACAAGAAGCTCAAACACTTGTGG
ACGATTGACGACATCGACGAGTCAAAGGTCCTCAAGAAGAATTGGTGGCATCAGCTCGGTCACCGGTGGCAGCAC
TACCTCCGCGTCGTCCCGGGCATGATGTTCATCAATGGGAGAAACCGGACTTCCTTTGCCGGATCCTGGACGCTG
GTGGTAAGACTGCCGAACCGAGGCCTGTAACAACGAAGGGAAAGGCTTACACATGAGCGTCCAGAACATGCACGA
GCTGGCCTGCGTCAGCGGCATCGCCGCCGCCTATCGCCTGGGGGCCGATTACCAACACTTTGACGACTTTGCCCA
AGATTTCTTTGCAAAATACCTCTTGCTGTCGCACGGCATGATCTTTTCCCGGCAGGAGAAGCGAAGGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail