Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3148
Gene name
LocationContig_28:49657..50698
Strand+
Gene length (bp)1041
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15365 PNRC Proline-rich nuclear receptor coactivator motif 5.6E-08 100 119

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3452
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3285
Ophiocordyceps australis map64 (Brazil) OphauB2|2782
Ophiocordyceps camponoti-floridani Ophcf2|06049
Ophiocordyceps camponoti-rufipedis Ophun1|3148 (this protein)
Ophiocordyceps kimflemingae Ophio5|2522
Ophiocordyceps subramaniannii Hirsu2|6580

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3148
MNGIPSHVATPAEPARPQKVYASENDATTPNGHRAAPQTPSKASPSPAEVYSQKSAFKQRSKNKIRAKNTPTSPE
IMPQAGRQTPPHRPGNLKPAICAAFAGATFHASPAPSALPIPSFVTRSLSDTPAQRGAREVVQEPSPPATDTDAP
TPLRTSSAPRSHESPLDFMFRAHRQEKERNGKDRAASSGQNTTARSPQPLSRLEVINSPTIVAASQARQASSKSP
FDGLDDSEQVGNQNLPMGPAFSAPYQERIKAARSDYARPHTQRMPEAAFTDAASAEDPAEALKKFLFGTPKREQG
PMSTSLQTAHKPQKWTTDGLSPGPSHSNNIQAMENDLRRILKLDLA*
Coding >Ophun1|3148
ATGAACGGCATTCCATCCCACGTCGCGACACCAGCCGAACCGGCCCGCCCTCAAAAGGTATATGCGTCTGAGAAC
GACGCGACAACACCCAACGGGCATCGCGCGGCGCCGCAAACCCCCAGCAAGGCGAGCCCATCGCCTGCCGAAGTC
TACTCTCAGAAATCAGCCTTCAAGCAGCGAAGCAAGAACAAGATCAGGGCTAAGAACACTCCTACGTCTCCCGAA
ATCATGCCCCAGGCCGGCCGCCAGACCCCGCCTCATCGACCCGGCAACCTGAAGCCCGCCATCTGCGCTGCTTTT
GCCGGTGCCACCTTTCACGCCTCCCCGGCTCCGTCAGCCTTGCCCATTCCGAGCTTTGTGACGAGGTCCCTGAGC
GACACTCCCGCTCAAAGGGGTGCGAGAGAAGTGGTTCAGGAACCTTCACCTCCCGCCACCGACACGGACGCGCCA
ACTCCGCTTCGTACTTCCTCGGCACCCCGGTCTCACGAGTCTCCGTTGGATTTCATGTTCCGCGCTCATCGACAG
GAGAAGGAGAGGAATGGAAAAGATCGCGCCGCTTCGTCCGGGCAGAATACCACGGCGCGCTCTCCGCAACCACTG
TCGCGTCTCGAGGTCATCAACTCTCCAACCATTGTCGCCGCCTCTCAGGCCCGGCAAGCATCGTCAAAATCGCCC
TTCGACGGTCTGGATGATTCCGAGCAGGTCGGCAATCAGAATCTTCCCATGGGCCCGGCCTTTTCGGCGCCGTAT
CAAGAACGAATCAAAGCCGCCCGCTCCGATTATGCCCGACCTCATACGCAGCGGATGCCGGAAGCAGCCTTCACC
GACGCAGCCTCGGCTGAAGATCCCGCCGAAGCCCTCAAGAAGTTTCTCTTCGGCACTCCTAAAAGGGAGCAAGGC
CCCATGTCAACAAGCCTCCAAACCGCGCACAAGCCGCAGAAATGGACCACCGATGGTCTTTCACCGGGACCCTCT
CACAGCAACAATATCCAGGCCATGGAGAACGACCTCCGACGGATTTTAAAACTCGATCTGGCTTAA
Transcript >Ophun1|3148
ATGAACGGCATTCCATCCCACGTCGCGACACCAGCCGAACCGGCCCGCCCTCAAAAGGTATATGCGTCTGAGAAC
GACGCGACAACACCCAACGGGCATCGCGCGGCGCCGCAAACCCCCAGCAAGGCGAGCCCATCGCCTGCCGAAGTC
TACTCTCAGAAATCAGCCTTCAAGCAGCGAAGCAAGAACAAGATCAGGGCTAAGAACACTCCTACGTCTCCCGAA
ATCATGCCCCAGGCCGGCCGCCAGACCCCGCCTCATCGACCCGGCAACCTGAAGCCCGCCATCTGCGCTGCTTTT
GCCGGTGCCACCTTTCACGCCTCCCCGGCTCCGTCAGCCTTGCCCATTCCGAGCTTTGTGACGAGGTCCCTGAGC
GACACTCCCGCTCAAAGGGGTGCGAGAGAAGTGGTTCAGGAACCTTCACCTCCCGCCACCGACACGGACGCGCCA
ACTCCGCTTCGTACTTCCTCGGCACCCCGGTCTCACGAGTCTCCGTTGGATTTCATGTTCCGCGCTCATCGACAG
GAGAAGGAGAGGAATGGAAAAGATCGCGCCGCTTCGTCCGGGCAGAATACCACGGCGCGCTCTCCGCAACCACTG
TCGCGTCTCGAGGTCATCAACTCTCCAACCATTGTCGCCGCCTCTCAGGCCCGGCAAGCATCGTCAAAATCGCCC
TTCGACGGTCTGGATGATTCCGAGCAGGTCGGCAATCAGAATCTTCCCATGGGCCCGGCCTTTTCGGCGCCGTAT
CAAGAACGAATCAAAGCCGCCCGCTCCGATTATGCCCGACCTCATACGCAGCGGATGCCGGAAGCAGCCTTCACC
GACGCAGCCTCGGCTGAAGATCCCGCCGAAGCCCTCAAGAAGTTTCTCTTCGGCACTCCTAAAAGGGAGCAAGGC
CCCATGTCAACAAGCCTCCAAACCGCGCACAAGCCGCAGAAATGGACCACCGATGGTCTTTCACCGGGACCCTCT
CACAGCAACAATATCCAGGCCATGGAGAACGACCTCCGACGGATTTTAAAACTCGATCTGGCTTAA
Gene >Ophun1|3148
ATGAACGGCATTCCATCCCACGTCGCGACACCAGCCGAACCGGCCCGCCCTCAAAAGGTATATGCGTCTGAGAAC
GACGCGACAACACCCAACGGGCATCGCGCGGCGCCGCAAACCCCCAGCAAGGCGAGCCCATCGCCTGCCGAAGTC
TACTCTCAGAAATCAGCCTTCAAGCAGCGAAGCAAGAACAAGATCAGGGCTAAGAACACTCCTACGTCTCCCGAA
ATCATGCCCCAGGCCGGCCGCCAGACCCCGCCTCATCGACCCGGCAACCTGAAGCCCGCCATCTGCGCTGCTTTT
GCCGGTGCCACCTTTCACGCCTCCCCGGCTCCGTCAGCCTTGCCCATTCCGAGCTTTGTGACGAGGTCCCTGAGC
GACACTCCCGCTCAAAGGGGTGCGAGAGAAGTGGTTCAGGAACCTTCACCTCCCGCCACCGACACGGACGCGCCA
ACTCCGCTTCGTACTTCCTCGGCACCCCGGTCTCACGAGTCTCCGTTGGATTTCATGTTCCGCGCTCATCGACAG
GAGAAGGAGAGGAATGGAAAAGATCGCGCCGCTTCGTCCGGGCAGAATACCACGGCGCGCTCTCCGCAACCACTG
TCGCGTCTCGAGGTCATCAACTCTCCAACCATTGTCGCCGCCTCTCAGGCCCGGCAAGCATCGTCAAAATCGCCC
TTCGACGGTCTGGATGATTCCGAGCAGGTCGGCAATCAGAATCTTCCCATGGGCCCGGCCTTTTCGGCGCCGTAT
CAAGAACGAATCAAAGCCGCCCGCTCCGATTATGCCCGACCTCATACGCAGCGGATGCCGGAAGCAGCCTTCACC
GACGCAGCCTCGGCTGAAGATCCCGCCGAAGCCCTCAAGAAGTTTCTCTTCGGCACTCCTAAAAGGGAGCAAGGC
CCCATGTCAACAAGCCTCCAAACCGCGCACAAGCCGCAGAAATGGACCACCGATGGTCTTTCACCGGGACCCTCT
CACAGCAACAATATCCAGGCCATGGAGAACGACCTCCGACGGATTTTAAAACTCGATCTGGCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail