Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3146
Gene name
LocationContig_28:46057..46436
Strand+
Gene length (bp)379
Transcript length (bp)270
Coding sequence length (bp)270
Protein length (aa) 90

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06645 SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12) 3.5E-29 17 86

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q61CQ8|SPCS1_CAEBR Probable signal peptidase complex subunit 1 OS=Caenorhabditis briggsae GN=CBG12804 PE=3 SV=1 17 82 2.0E-13
sp|O44953|SPCS1_CAEEL Probable signal peptidase complex subunit 1 OS=Caenorhabditis elegans GN=C34B2.10 PE=3 SV=1 17 82 3.0E-12
sp|Q944J0|SPCS1_ARATH Probable signal peptidase complex subunit 1 OS=Arabidopsis thaliana GN=At2g22425 PE=2 SV=1 17 83 5.0E-12
sp|Q5RF96|SPCS1_PONAB Signal peptidase complex subunit 1 OS=Pongo abelii GN=SPCS1 PE=3 SV=1 9 84 2.0E-10
sp|Q9Y6A9|SPCS1_HUMAN Signal peptidase complex subunit 1 OS=Homo sapiens GN=SPCS1 PE=1 SV=4 9 84 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q61CQ8|SPCS1_CAEBR Probable signal peptidase complex subunit 1 OS=Caenorhabditis briggsae GN=CBG12804 PE=3 SV=1 17 82 2.0E-13
sp|O44953|SPCS1_CAEEL Probable signal peptidase complex subunit 1 OS=Caenorhabditis elegans GN=C34B2.10 PE=3 SV=1 17 82 3.0E-12
sp|Q944J0|SPCS1_ARATH Probable signal peptidase complex subunit 1 OS=Arabidopsis thaliana GN=At2g22425 PE=2 SV=1 17 83 5.0E-12
sp|Q5RF96|SPCS1_PONAB Signal peptidase complex subunit 1 OS=Pongo abelii GN=SPCS1 PE=3 SV=1 9 84 2.0E-10
sp|Q9Y6A9|SPCS1_HUMAN Signal peptidase complex subunit 1 OS=Homo sapiens GN=SPCS1 PE=1 SV=4 9 84 2.0E-10
sp|B0FWK4|SPCS1_PIG Signal peptidase complex subunit 1 OS=Sus scrofa GN=SPCS1 PE=3 SV=1 9 84 2.0E-10
sp|Q3T134|SPCS1_BOVIN Signal peptidase complex subunit 1 OS=Bos taurus GN=SPCS1 PE=3 SV=1 9 84 2.0E-10
sp|Q9D958|SPCS1_MOUSE Signal peptidase complex subunit 1 OS=Mus musculus GN=Spcs1 PE=2 SV=3 9 84 4.0E-10
sp|P46965|SPC1_YEAST Signal peptidase complex subunit SPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC1 PE=1 SV=1 1 82 1.0E-09
sp|Q9VAL0|SPCS1_DROME Signal peptidase complex subunit 1 OS=Drosophila melanogaster GN=Spase12 PE=1 SV=2 17 82 2.0E-09
sp|G2TRR4|SPC1_SCHPO Microsomal signal peptidase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=new19 PE=2 SV=1 13 82 1.0E-08
sp|Q54Y83|SPCS1_DICDI Signal peptidase complex subunit 1 OS=Dictyostelium discoideum GN=spcs1 PE=3 SV=1 17 82 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0006465 signal peptide processing Yes
GO:0005787 signal peptidase complex Yes
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0031224 intrinsic component of membrane No
GO:1902494 catalytic complex No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0006518 peptide metabolic process No
GO:0098796 membrane protein complex No
GO:0016485 protein processing No
GO:0032991 protein-containing complex No
GO:0051604 protein maturation No
GO:0006508 proteolysis No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0043603 cellular amide metabolic process No
GO:1905368 peptidase complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 27 46 19
2 53 75 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3146
MAEEVLDQLRHLVDGPIDFDGQRRAEGFATLLLAISGLLAFNIGYHYQDIQKAVYIGLGGTLLTFLVVVPPWPFY
NKNPVKWLPAGSGL*
Coding >Ophun1|3146
ATGGCCGAAGAGGTTCTTGACCAGCTCCGTCATCTGGTAGACGGGCCCATCGATTTCGACGGTCAACGGCGAGCT
GAAGGCTTCGCTACGCTCCTGCTCGCCATCTCCGGGCTTCTGGCCTTCAACATCGGTTACCACTACCAGGACATT
CAAAAGGCCGTCTACATCGGACTTGGAGGAACACTACTGACATTTCTTGTCGTGGTGCCGCCGTGGCCGTTCTAC
AACAAGAACCCCGTCAAATGGCTACCTGCCGGCTCGGGATTGTGA
Transcript >Ophun1|3146
ATGGCCGAAGAGGTTCTTGACCAGCTCCGTCATCTGGTAGACGGGCCCATCGATTTCGACGGTCAACGGCGAGCT
GAAGGCTTCGCTACGCTCCTGCTCGCCATCTCCGGGCTTCTGGCCTTCAACATCGGTTACCACTACCAGGACATT
CAAAAGGCCGTCTACATCGGACTTGGAGGAACACTACTGACATTTCTTGTCGTGGTGCCGCCGTGGCCGTTCTAC
AACAAGAACCCCGTCAAATGGCTACCTGCCGGCTCGGGATTGTGA
Gene >Ophun1|3146
ATGGCCGAAGAGGTTCTTGACCAGCTCCGTCATCTGGTAGACGGGCCCATCGTACGGCTTCTACTGCTATCACCC
CGCTGTCTTACCTCTCTCTGATTCCATGCAAAGGATTTCGACGGTCAACGGCGAGCTGAAGGCTTCGCTACGCTC
CTGCTCGCCATCTCCGGGGTACGGTCCTTGCTTCCGCGTCCCAGCCGGTCCGCTAATCACGAAACCAAAGCTTCT
GGCCTTCAACATCGGTTACCACTACCAGGACATTCAAAAGGCCGTCTACATCGGACTTGGAGGAACACTACTGAC
ATTTCTTGTCGTGGTGCCGCCGTGGCCGTTCTACAACAAGAACCCCGTCAAATGGCTACCTGCCGGCTCGGGATT
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail