Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3145
Gene name
LocationContig_28:43063..44952
Strand-
Gene length (bp)1889
Transcript length (bp)1830
Coding sequence length (bp)1830
Protein length (aa) 610

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01544 CorA CorA-like Mg2+ transporter protein 2.3E-42 301 604

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13657|YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi066 PE=1 SV=1 162 608 9.0E-122
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 261 609 9.0E-108
sp|Q08269|ALR1_YEAST Magnesium transporter ALR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR1 PE=1 SV=1 156 588 8.0E-103
sp|P43553|ALR2_YEAST Magnesium transporter ALR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR2 PE=1 SV=1 236 602 4.0E-100
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 453 597 4.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13657|YBCC_SCHPO Putative metal ion transporter C27B12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi066 PE=1 SV=1 162 608 9.0E-122
sp|O13779|YF2E_SCHPO Putative metal ion transporter C17A12.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.14 PE=1 SV=4 261 609 9.0E-108
sp|Q08269|ALR1_YEAST Magnesium transporter ALR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR1 PE=1 SV=1 156 588 8.0E-103
sp|P43553|ALR2_YEAST Magnesium transporter ALR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALR2 PE=1 SV=1 236 602 4.0E-100
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 453 597 4.0E-43
sp|Q9WZ31|CORA_THEMA Magnesium transport protein CorA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=corA PE=1 SV=1 294 609 5.0E-22
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 360 447 3.0E-20
sp|P35724|MNR2_YEAST Manganese resistance protein MNR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNR2 PE=1 SV=1 255 360 6.0E-15
sp|O31543|YFJQ_BACSU Putative metal ion transporter YfjQ OS=Bacillus subtilis (strain 168) GN=yfjQ PE=3 SV=1 303 605 2.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0030001 metal ion transport Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0006810 transport No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0008324 cation transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0051179 localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 547 569 22
2 584 603 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3145
MSEQDSTTMDTGFGAPVPELDDHRHQPAPAQRSERSRRGTFDSLYGARQLDMDANASCIRVRDFEEAVVDEDALE
VPTITRHGRRPTAETPNDLRQPSPPNSVKAFAQARRRERDLSFSEPKGELEDGPGRATSISSRRSHRSKPRTIEN
DAGSLRTNKEAEENVCYPMKDGRRNHELRIDFDYLESFINAERAARVDSRQPPMEVFEDMRIQQSSPRRNQLATA
DGDIMDMPLEESVSNEKATAEATVKPAATHFVDKNRFSFFSSAWESTIHAAEMGDLVLPGEDIRGLFELPKDDAD
GVWWLNVNHASKEEVQGICKAFGVHPLTMEDIITQEAREKIELFQSYYFACFRSFNIVDEPDGVEYEPFNIYVLV
FREGTLSFSFAPNSHASQVRKRITALKEYVSLSSDWICYALIDNIVDSFAPVIRTLELEADAIEDEVFVMRQDDS
SSFLRTIGRVRKNCMALLRLLGGKADVLRGFTKRCNENYQVTPHMDIGMYLGDIQDHVVTMATNLGHFEKMLSRA
HSNYLATLSINSISQGTDTNRVLSKITFLASVLVPLNLISGVFGMNVPVPFQKSDRLEPFFGIIGCMILVCSLIL
GWARWKRYI*
Coding >Ophun1|3145
ATGTCTGAGCAGGACTCCACCACCATGGACACGGGATTTGGTGCCCCGGTCCCGGAGCTCGACGACCACCGGCAC
CAGCCTGCTCCCGCTCAGCGCAGCGAGCGCTCCCGAAGAGGAACCTTTGACTCCCTCTATGGCGCTCGCCAGCTC
GACATGGACGCAAATGCTTCTTGCATACGGGTGCGGGATTTCGAAGAGGCCGTCGTCGACGAAGACGCCCTTGAA
GTCCCCACCATTACTCGCCACGGTCGTCGTCCAACCGCCGAAACGCCAAACGATCTCCGACAGCCGTCTCCTCCC
AACTCGGTCAAGGCATTCGCCCAGGCTCGACGAAGGGAGCGCGACCTCTCCTTCTCCGAGCCCAAGGGTGAGCTC
GAAGACGGGCCCGGCCGTGCCACGTCTATATCGAGCCGTCGCAGTCATCGGAGCAAACCTCGCACGATAGAGAAT
GACGCTGGAAGCCTCCGGACGAACAAGGAAGCCGAGGAGAATGTCTGCTATCCTATGAAGGATGGCCGTCGGAAC
CACGAGCTTCGCATCGACTTTGACTACCTCGAAAGCTTCATCAACGCAGAGCGGGCAGCCCGGGTCGATAGCCGG
CAGCCGCCCATGGAAGTATTCGAAGACATGCGAATCCAGCAGTCGAGCCCCCGCCGCAATCAGCTCGCTACTGCT
GACGGAGACATCATGGACATGCCCTTGGAGGAGTCGGTATCCAACGAAAAGGCAACGGCAGAGGCAACGGTCAAG
CCGGCAGCAACTCATTTTGTGGATAAGAACCGCTTCAGTTTCTTCTCGTCTGCCTGGGAGTCGACAATCCACGCC
GCCGAGATGGGCGATCTCGTCCTGCCTGGAGAAGATATCCGCGGTCTTTTCGAGCTCCCCAAGGACGATGCGGAT
GGAGTTTGGTGGCTGAACGTCAATCACGCTTCCAAGGAGGAGGTTCAAGGGATCTGCAAGGCGTTTGGAGTTCAC
CCGCTAACAATGGAAGACATCATCACCCAGGAAGCACGCGAGAAGATTGAGCTGTTCCAGTCGTACTACTTTGCG
TGCTTCCGGTCCTTCAACATTGTCGATGAGCCCGACGGGGTCGAGTACGAGCCCTTCAACATCTACGTGCTCGTC
TTTCGGGAAGGCACACTGAGTTTCAGCTTCGCCCCCAACTCGCACGCGTCTCAAGTCCGGAAGAGAATCACTGCC
CTCAAGGAATACGTGTCCCTGAGCAGCGACTGGATCTGCTATGCTTTGATTGATAACATTGTGGATTCCTTCGCT
CCCGTCATCCGGACCCTCGAGCTCGAAGCCGACGCCATCGAAGACGAAGTCTTTGTCATGCGACAGGACGACTCG
AGCTCCTTTCTCCGTACCATTGGGCGAGTGCGCAAGAACTGCATGGCCCTGCTGCGACTTCTCGGCGGCAAGGCC
GACGTGCTACGAGGCTTCACCAAGCGCTGCAACGAGAACTACCAAGTGACGCCGCACATGGACATCGGAATGTAT
CTCGGCGACATCCAGGATCACGTTGTGACGATGGCGACCAACCTGGGACACTTTGAGAAGATGCTGTCCAGGGCA
CACAGCAACTACCTGGCGACACTGTCCATTAATAGCATCTCGCAGGGAACCGACACTAACCGCGTGCTGAGCAAA
ATTACCTTCTTAGCCTCGGTTCTTGTACCGTTGAACCTGATCAGTGGCGTCTTCGGTATGAACGTGCCGGTCCCC
TTCCAAAAGTCGGATCGACTGGAGCCCTTTTTCGGCATCATCGGCTGCATGATTCTCGTGTGTTCACTGATCTTG
GGCTGGGCGAGATGGAAGCGGTACATCTAA
Transcript >Ophun1|3145
ATGTCTGAGCAGGACTCCACCACCATGGACACGGGATTTGGTGCCCCGGTCCCGGAGCTCGACGACCACCGGCAC
CAGCCTGCTCCCGCTCAGCGCAGCGAGCGCTCCCGAAGAGGAACCTTTGACTCCCTCTATGGCGCTCGCCAGCTC
GACATGGACGCAAATGCTTCTTGCATACGGGTGCGGGATTTCGAAGAGGCCGTCGTCGACGAAGACGCCCTTGAA
GTCCCCACCATTACTCGCCACGGTCGTCGTCCAACCGCCGAAACGCCAAACGATCTCCGACAGCCGTCTCCTCCC
AACTCGGTCAAGGCATTCGCCCAGGCTCGACGAAGGGAGCGCGACCTCTCCTTCTCCGAGCCCAAGGGTGAGCTC
GAAGACGGGCCCGGCCGTGCCACGTCTATATCGAGCCGTCGCAGTCATCGGAGCAAACCTCGCACGATAGAGAAT
GACGCTGGAAGCCTCCGGACGAACAAGGAAGCCGAGGAGAATGTCTGCTATCCTATGAAGGATGGCCGTCGGAAC
CACGAGCTTCGCATCGACTTTGACTACCTCGAAAGCTTCATCAACGCAGAGCGGGCAGCCCGGGTCGATAGCCGG
CAGCCGCCCATGGAAGTATTCGAAGACATGCGAATCCAGCAGTCGAGCCCCCGCCGCAATCAGCTCGCTACTGCT
GACGGAGACATCATGGACATGCCCTTGGAGGAGTCGGTATCCAACGAAAAGGCAACGGCAGAGGCAACGGTCAAG
CCGGCAGCAACTCATTTTGTGGATAAGAACCGCTTCAGTTTCTTCTCGTCTGCCTGGGAGTCGACAATCCACGCC
GCCGAGATGGGCGATCTCGTCCTGCCTGGAGAAGATATCCGCGGTCTTTTCGAGCTCCCCAAGGACGATGCGGAT
GGAGTTTGGTGGCTGAACGTCAATCACGCTTCCAAGGAGGAGGTTCAAGGGATCTGCAAGGCGTTTGGAGTTCAC
CCGCTAACAATGGAAGACATCATCACCCAGGAAGCACGCGAGAAGATTGAGCTGTTCCAGTCGTACTACTTTGCG
TGCTTCCGGTCCTTCAACATTGTCGATGAGCCCGACGGGGTCGAGTACGAGCCCTTCAACATCTACGTGCTCGTC
TTTCGGGAAGGCACACTGAGTTTCAGCTTCGCCCCCAACTCGCACGCGTCTCAAGTCCGGAAGAGAATCACTGCC
CTCAAGGAATACGTGTCCCTGAGCAGCGACTGGATCTGCTATGCTTTGATTGATAACATTGTGGATTCCTTCGCT
CCCGTCATCCGGACCCTCGAGCTCGAAGCCGACGCCATCGAAGACGAAGTCTTTGTCATGCGACAGGACGACTCG
AGCTCCTTTCTCCGTACCATTGGGCGAGTGCGCAAGAACTGCATGGCCCTGCTGCGACTTCTCGGCGGCAAGGCC
GACGTGCTACGAGGCTTCACCAAGCGCTGCAACGAGAACTACCAAGTGACGCCGCACATGGACATCGGAATGTAT
CTCGGCGACATCCAGGATCACGTTGTGACGATGGCGACCAACCTGGGACACTTTGAGAAGATGCTGTCCAGGGCA
CACAGCAACTACCTGGCGACACTGTCCATTAATAGCATCTCGCAGGGAACCGACACTAACCGCGTGCTGAGCAAA
ATTACCTTCTTAGCCTCGGTTCTTGTACCGTTGAACCTGATCAGTGGCGTCTTCGGTATGAACGTGCCGGTCCCC
TTCCAAAAGTCGGATCGACTGGAGCCCTTTTTCGGCATCATCGGCTGCATGATTCTCGTGTGTTCACTGATCTTG
GGCTGGGCGAGATGGAAGCGGTACATCTAA
Gene >Ophun1|3145
ATGTCTGAGCAGGACTCCACCACCATGGACACGGGATTTGGTGCCCCGGTCCCGGAGCTCGACGACCACCGGCAC
CAGCCTGCTCCCGCTCAGCGCAGCGAGCGCTCCCGAAGAGGAACCTTTGACTCCCTCTATGGCGCTCGCCAGCTC
GACATGGACGCAAATGCTTCTTGCATACGGGTGCGGGATTTCGAAGAGGCCGTCGTCGACGAAGACGCCCTTGAA
GTCCCCACCATTACTCGCCACGGTCGTCGTCCAACCGCCGAAACGCCAAACGATCTCCGACAGCCGTCTCCTCCC
AACTCGGTCAAGGCATTCGCCCAGGCTCGACGAAGGGAGCGCGACCTCTCCTTCTCCGAGCCCAAGGGTGAGCTC
GAAGACGGGCCCGGCCGTGCCACGTCTATATCGAGCCGTCGCAGTCATCGGAGCAAACCTCGCACGATAGAGAAT
GACGCTGGAAGCCTCCGGACGAACAAGGAAGCCGAGGAGAATGTCTGCTATCCTATGAAGGATGGCCGTCGGAAC
CACGAGCTTCGCATCGACTTTGACTACCTCGAAAGCTTCATCAACGCAGAGCGGGCAGCCCGGGTCGATAGCCGG
CAGCCGCCCATGGAAGTATTCGAAGACATGCGAATCCAGCAGTCGAGCCCCCGCCGCAATCAGCTCGCTACTGCT
GACGGAGACATCATGGACATGCCCTTGGAGGAGTCGGTATCCAACGAAAAGGCAACGGCAGAGGCAACGGTCAAG
CCGGCAGCAACTCATTTTGTGGATAAGAACCGCTTCAGTTTCTTCTCGTCTGCCTGGGAGTCGACAATCCACGCC
GCCGAGATGGGCGATCTCGTCCTGCCTGGAGAAGATATCCGCGGTCTTTTCGAGCTCCCCAAGGACGATGCGGAT
GGAGTTTGGTGGCTGAACGTCAATCACGCTTCCAAGGAGGAGGTTCAAGGGATCTGCAAGGCGTTTGGAGTTCAC
CCGCTAACAATGGAAGACATCATCACCCAGGAAGCACGCGAGAAGATTGAGCTGTTCCAGTCGTACTACTTTGCG
TGCTTCCGGTCCTTCAACATTGTCGATGAGCCCGACGGGGTCGAGTACGAGCCCTTCAACATCTACGTGCTCGTC
TTTCGGGAAGGCACACTGAGTTTCAGCTTCGCCCCCAACTCGCACGCGTCTCAAGTCCGGAAGAGAATCACTGCC
CTCAAGGAATACGTGTCCCTGAGCAGCGACTGGATCTGCTATGCTTTGATGTACGCGCCTTGTGCGGGGCTTGCC
TCCCCCTCGACCTAGGTACTGATGTCTGTGATAGTGATAACATTGTGGATTCCTTCGCTCCCGTCATCCGGACCC
TCGAGCTCGAAGCCGACGCCATCGAAGACGAAGTCTTTGTCATGCGACAGGACGACTCGAGCTCCTTTCTCCGTA
CCATTGGGCGAGTGCGCAAGAACTGCATGGCCCTGCTGCGACTTCTCGGCGGCAAGGCCGACGTGCTACGAGGCT
TCACCAAGCGCTGCAACGAGAACTACCAAGTGACGCCGCACATGGACATCGGAATGTATCTCGGCGACATCCAGG
ATCACGTTGTGACGATGGCGACCAACCTGGGACACTTTGAGAAGATGCTGTCCAGGGCACACAGCAACTACCTGG
CGACACTGTCCATTAATAGCATCTCGCAGGGAACCGACACTAACCGCGTGCTGAGCAAAATTACCTTCTTAGCCT
CGGTTCTTGTACCGTTGAACCTGATCAGTGGCGTCTTCGGTATGAACGTGCCGGTCCCCTTCCAAAAGTCGGATC
GACTGGAGCCCTTTTTCGGCATCATCGGCTGCATGATTCTCGTGTGTTCACTGATCTTGGGCTGGGCGAGATGGA
AGCGGTACATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail