Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3138
Gene name
LocationContig_28:24536..25643
Strand-
Gene length (bp)1107
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04116 FA_hydroxylase Fatty acid hydroxylase 1.8E-25 169 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 1 345 2.0E-166
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 1 347 6.0E-149
sp|Q754B9|ERG3_ASHGO Delta(7)-sterol 5(6)-desaturase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG3 PE=3 SV=2 1 337 7.0E-105
sp|O94457|ERG31_SCHPO Delta(7)-sterol 5(6)-desaturase erg31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg31 PE=3 SV=1 68 345 6.0E-102
sp|P50860|ERG3_CANGA Delta(7)-sterol 5(6)-desaturase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG3 PE=3 SV=1 1 340 1.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SBB6|ERG3_NEUCR Probable Delta(7)-sterol 5(6)-desaturase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=NCU06207 PE=3 SV=1 1 345 2.0E-166
sp|Q8J207|ERG3_LEPMC Delta(7)-sterol 5(6)-desaturase OS=Leptosphaeria maculans GN=ERG3 PE=3 SV=1 1 347 6.0E-149
sp|Q754B9|ERG3_ASHGO Delta(7)-sterol 5(6)-desaturase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG3 PE=3 SV=2 1 337 7.0E-105
sp|O94457|ERG31_SCHPO Delta(7)-sterol 5(6)-desaturase erg31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg31 PE=3 SV=1 68 345 6.0E-102
sp|P50860|ERG3_CANGA Delta(7)-sterol 5(6)-desaturase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG3 PE=3 SV=1 1 340 1.0E-99
sp|O93875|ERG3_CANAX Delta(7)-sterol 5(6)-desaturase OS=Candida albicans GN=ERG3 PE=3 SV=1 1 337 1.0E-99
sp|P32353|ERG3_YEAST Delta(7)-sterol 5(6)-desaturase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG3 PE=1 SV=1 1 345 1.0E-98
sp|O13666|ERG32_SCHPO Delta(7)-sterol 5(6)-desaturase erg32 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg32 PE=3 SV=1 1 340 9.0E-95
sp|Q8NJ57|ERG3_CANDC Delta(7)-sterol 5(6)-desaturase OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ERG3 PE=3 SV=1 1 337 9.0E-94
sp|O88822|SC5D_MOUSE Lathosterol oxidase OS=Mus musculus GN=Sc5d PE=2 SV=2 63 336 5.0E-84
sp|Q9EQS5|SC5D_RAT Lathosterol oxidase OS=Rattus norvegicus GN=Sc5d PE=1 SV=1 63 314 1.0E-82
sp|O75845|SC5D_HUMAN Lathosterol oxidase OS=Homo sapiens GN=SC5D PE=1 SV=2 63 320 8.0E-81
sp|Q9M883|SC5D2_ARATH Putative Delta(7)-sterol-C5(6)-desaturase 2 OS=Arabidopsis thaliana GN=HDF7 PE=3 SV=1 73 301 4.0E-23
sp|Q9ZT29|SC5D_TOBAC Delta(7)-sterol-C5(6)-desaturase OS=Nicotiana tabacum PE=2 SV=1 72 310 3.0E-19
sp|Q39208|SC5D1_ARATH Delta(7)-sterol-C5(6)-desaturase 1 OS=Arabidopsis thaliana GN=STE1 PE=1 SV=2 72 314 1.0E-18
sp|Q9AST3|SBH2_ARATH Sphinganine C4-monooxygenase 2 OS=Arabidopsis thaliana GN=SBH2 PE=1 SV=1 167 296 8.0E-11
sp|Q55D54|MSMOB_DICDI Putative methylsterol monooxygenase DDB_G0269788 OS=Dictyostelium discoideum GN=DDB_G0269788 PE=3 SV=1 159 324 5.0E-10
sp|Q55D52|MSMOA_DICDI Putative methylsterol monooxygenase DDB_G0270946 OS=Dictyostelium discoideum GN=DDB_G0270946 PE=3 SV=2 123 295 1.0E-09
sp|Q96IV6|FXDC2_HUMAN Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens GN=FAXDC2 PE=2 SV=1 165 298 2.0E-09
sp|Q9CRA4|MSMO1_MOUSE Methylsterol monooxygenase 1 OS=Mus musculus GN=Msmo1 PE=1 SV=1 180 314 5.0E-09
sp|Q9GKT2|FXDC2_MACFA Fatty acid hydroxylase domain-containing protein 2 OS=Macaca fascicularis GN=FAXDC2 PE=2 SV=1 165 298 5.0E-09
sp|F4JLZ6|SMO13_ARATH Methylsterol monooxygenase 1-3 OS=Arabidopsis thaliana GN=SMO1-3 PE=2 SV=1 159 314 6.0E-09
sp|Q8L7W5|SMO11_ARATH Methylsterol monooxygenase 1-1 OS=Arabidopsis thaliana GN=SMO1-1 PE=1 SV=1 167 328 1.0E-08
sp|Q1EC69|SMO12_ARATH Methylsterol monooxygenase 1-2 OS=Arabidopsis thaliana GN=SMO1-2 PE=2 SV=1 165 324 1.0E-08
sp|O35532|MSMO1_RAT Methylsterol monooxygenase 1 OS=Rattus norvegicus GN=Msmo1 PE=2 SV=1 180 314 2.0E-08
sp|Q5ZLL6|MSMO1_CHICK Methylsterol monooxygenase 1 OS=Gallus gallus GN=MSMO1 PE=2 SV=1 180 309 2.0E-08
sp|P53045|MSMO_YEAST Methylsterol monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG25 PE=1 SV=1 159 323 3.0E-08
sp|Q5R574|MSMO1_PONAB Methylsterol monooxygenase 1 OS=Pongo abelii GN=MSMO1 PE=2 SV=1 180 313 8.0E-08
sp|Q15800|MSMO1_HUMAN Methylsterol monooxygenase 1 OS=Homo sapiens GN=MSMO1 PE=1 SV=1 180 313 8.0E-08
sp|Q8VYI1|SBH1_ARATH Sphinganine C4-monooxygenase 1 OS=Arabidopsis thaliana GN=SBH1 PE=1 SV=1 167 320 9.0E-08
sp|Q6UGB2|MSMO1_PIG Methylsterol monooxygenase 1 OS=Sus scrofa GN=MSMO1 PE=2 SV=1 180 314 1.0E-07
sp|Q7ZW77|MSMO1_DANRE Methylsterol monooxygenase 1 OS=Danio rerio GN=msmo1 PE=2 SV=1 180 295 1.0E-07
sp|Q4R4Q4|MSMO1_MACFA Methylsterol monooxygenase 1 OS=Macaca fascicularis GN=MSMO1 PE=2 SV=1 180 295 1.0E-06
sp|Q618G2|C25HL_CAEBR Cholesterol 25-hydroxylase-like protein OS=Caenorhabditis briggsae GN=CBG14675 PE=3 SV=1 158 317 1.0E-06
sp|P38992|SUR2_YEAST Sphingolipid C4-hydroxylase SUR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUR2 PE=1 SV=1 160 325 6.0E-06
sp|O59933|MSMO_CANAL Methylsterol monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG25 PE=3 SV=1 165 322 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0005506 iron ion binding Yes
GO:0008610 lipid biosynthetic process Yes
GO:1901576 organic substance biosynthetic process No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0006629 lipid metabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 82 104 22
2 160 182 22
3 231 253 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3569
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|274
Ophiocordyceps australis map64 (Brazil) OphauB2|7137
Ophiocordyceps camponoti-floridani Ophcf2|06040
Ophiocordyceps camponoti-rufipedis Ophun1|3138 (this protein)
Ophiocordyceps kimflemingae Ophio5|6636
Ophiocordyceps subramaniannii Hirsu2|6862
Ophiocordyceps subramaniannii Hirsu2|8522

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3138
MDVVLELTDTFITDYAYAYLFPARQAPYDFPKAAAANGSEKTFSPWTYVPASHFIQIQPSQAAYKTSLPRDNPLR
QLVTLFFITWIFGIIVYFLFATLSYYIIFDKRTLNHPKFIRNQIWLEIVQANKSMPIMAIFTAPLFFLEVRGYGR
LYDTTDQGPGMWYNVMQFPLFLLFTDFCIYWIHRFLHHPLIYKRIHKPHHKWIMPTPYASHAFHPLDGFAQSLPY
HFFPFIFPLQKMAYVVLFVFVNFWSILIHDGEYLTNNPIVNGAACHSLHHSRFEVNYGQFFTAFDRLGGTYRMPE
AWMFEREKKMSEKQWKQESKTVDGFVKEIEGSDERTYGPELAAKKMK*
Coding >Ophun1|3138
ATGGACGTGGTGCTCGAGCTCACAGACACCTTCATCACCGACTACGCCTACGCCTATCTCTTTCCCGCCCGTCAA
GCCCCGTACGACTTCCCCAAAGCTGCGGCGGCCAATGGCTCTGAGAAGACGTTTTCGCCCTGGACATATGTGCCC
GCCTCCCACTTCATTCAGATCCAGCCGTCGCAGGCCGCATACAAGACGTCGCTGCCCCGGGACAATCCCCTTCGC
CAGCTCGTCACCTTGTTCTTCATCACCTGGATCTTTGGCATCATCGTCTATTTCCTCTTTGCCACTCTCTCCTAT
TACATCATCTTCGATAAGCGCACACTGAACCATCCCAAATTCATCCGCAATCAGATATGGCTCGAGATCGTCCAG
GCCAACAAGTCGATGCCCATCATGGCCATCTTCACCGCTCCCCTCTTCTTTCTCGAGGTTCGCGGCTACGGTCGG
CTCTACGACACAACGGACCAGGGACCGGGCATGTGGTACAATGTGATGCAGTTTCCCCTGTTTCTCTTGTTTACC
GACTTTTGCATCTACTGGATCCATCGTTTTCTTCACCATCCTCTCATCTACAAGCGCATCCACAAGCCTCACCAC
AAATGGATCATGCCGACGCCCTATGCGAGCCATGCCTTTCACCCGCTCGACGGCTTCGCCCAATCGCTTCCCTAC
CATTTCTTCCCTTTCATCTTTCCCTTGCAAAAGATGGCTTACGTCGTGCTCTTCGTCTTTGTCAACTTCTGGTCC
ATCCTCATCCACGACGGAGAATACCTCACCAACAACCCCATCGTCAACGGCGCCGCATGCCACTCGCTGCATCAC
TCTCGCTTCGAGGTCAACTACGGACAGTTCTTCACCGCCTTTGATCGCCTCGGCGGCACTTACCGCATGCCCGAG
GCCTGGATGTTTGAGAGGGAGAAGAAGATGTCGGAGAAGCAGTGGAAGCAAGAGTCCAAGACGGTCGACGGCTTT
GTCAAGGAGATTGAAGGTTCTGACGAGCGTACATATGGTCCCGAATTGGCTGCCAAGAAGATGAAGTGA
Transcript >Ophun1|3138
ATGGACGTGGTGCTCGAGCTCACAGACACCTTCATCACCGACTACGCCTACGCCTATCTCTTTCCCGCCCGTCAA
GCCCCGTACGACTTCCCCAAAGCTGCGGCGGCCAATGGCTCTGAGAAGACGTTTTCGCCCTGGACATATGTGCCC
GCCTCCCACTTCATTCAGATCCAGCCGTCGCAGGCCGCATACAAGACGTCGCTGCCCCGGGACAATCCCCTTCGC
CAGCTCGTCACCTTGTTCTTCATCACCTGGATCTTTGGCATCATCGTCTATTTCCTCTTTGCCACTCTCTCCTAT
TACATCATCTTCGATAAGCGCACACTGAACCATCCCAAATTCATCCGCAATCAGATATGGCTCGAGATCGTCCAG
GCCAACAAGTCGATGCCCATCATGGCCATCTTCACCGCTCCCCTCTTCTTTCTCGAGGTTCGCGGCTACGGTCGG
CTCTACGACACAACGGACCAGGGACCGGGCATGTGGTACAATGTGATGCAGTTTCCCCTGTTTCTCTTGTTTACC
GACTTTTGCATCTACTGGATCCATCGTTTTCTTCACCATCCTCTCATCTACAAGCGCATCCACAAGCCTCACCAC
AAATGGATCATGCCGACGCCCTATGCGAGCCATGCCTTTCACCCGCTCGACGGCTTCGCCCAATCGCTTCCCTAC
CATTTCTTCCCTTTCATCTTTCCCTTGCAAAAGATGGCTTACGTCGTGCTCTTCGTCTTTGTCAACTTCTGGTCC
ATCCTCATCCACGACGGAGAATACCTCACCAACAACCCCATCGTCAACGGCGCCGCATGCCACTCGCTGCATCAC
TCTCGCTTCGAGGTCAACTACGGACAGTTCTTCACCGCCTTTGATCGCCTCGGCGGCACTTACCGCATGCCCGAG
GCCTGGATGTTTGAGAGGGAGAAGAAGATGTCGGAGAAGCAGTGGAAGCAAGAGTCCAAGACGGTCGACGGCTTT
GTCAAGGAGATTGAAGGTTCTGACGAGCGTACATATGGTCCCGAATTGGCTGCCAAGAAGATGAAGTGA
Gene >Ophun1|3138
ATGGACGTGGTGCTCGAGCTCACAGACACCTTCATCACCGACTACGCCTACGCCTATCTCTTTCCCGCCCGTCAA
GCCCCGTACGACTTCCCCAAAGCTGCGGCGGCCAATGGCTCTGAGAAGACGTTTTCGCCCTGGACATATGTGCCC
GCCTCCCACTTCATTCAGATCCAGCCGTCGCAGGCCGCATACAAGACGTCGCTGCCCCGGGACAATCCCCTTCGC
CAGCTCGTCACCTTGTTCTTCATCACCTGGTACGAATTGGTCTGTTTTCCTGGCCGCTACTTGAGCTGACGCGAT
GCGACGTACGTCTGTAGGATCTTTGGCATCATCGTCTATTTCCTCTTTGCCACTCTCTCCTATTACATCATCTTC
GATAAGCGCACACTGAACCATCCCAAATTCATCCGCAATCAGATATGGCTCGAGATCGTCCAGGCCAACAAGTCG
ATGCCCATCATGGCCATCTTCACCGCTCCCCTCTTCTTTCTCGAGGTTCGCGGCTACGGTCGGCTCTACGACACA
ACGGACCAGGGACCGGGCATGTGGTACAATGTGATGCAGTTTCCCCTGTTTCTCTTGTTTACCGACTTTTGCATC
TACTGGATCCATCGTTTTCTTCACCATCCTCTCATCTACAAGCGCATCCACAAGCCTCACCACAAATGGATCATG
CCGACGCCCTATGCGAGCCATGCCTTTCACCCGCTCGACGGCTTCGCCCAATCGCTTCCCTACCATTTCTTCCCT
TTCATCTTTCCCTTGCAAAAGATGGCTTACGTCGTGCTCTTCGTCTTTGTCAACTTCTGGTCCATCCTCATCCAC
GACGGAGAATACCTCACCAACAACCCCATCGTCAACGGCGCCGCATGCCACTCGCTGCATCACTCTCGCTTCGAG
GTCAACTACGGACAGTTCTTCACCGCCTTTGATCGCCTCGGCGGCACTTACCGCATGCCCGAGGCCTGGATGTTT
GAGAGGGAGAAGAAGATGTCGGAGAAGCAGTGGAAGCAAGAGTCCAAGACGGTCGACGGCTTTGTCAAGGAGATT
GAAGGTTCTGACGAGCGTACATATGGTCCCGAATTGGCTGCCAAGAAGATGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail