Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3136
Gene name
LocationContig_28:22550..23249
Strand-
Gene length (bp)699
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01778 Ribosomal_L28e Ribosomal L28e protein family 1.6E-35 13 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14069|RL28E_SCHPO Probable 60S ribosomal protein L28e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl44 PE=1 SV=1 9 137 6.0E-29
sp|O82204|RL281_ARATH 60S ribosomal protein L28-1 OS=Arabidopsis thaliana GN=RPL28A PE=2 SV=1 7 145 2.0E-22
sp|Q9M0E2|RL282_ARATH 60S ribosomal protein L28-2 OS=Arabidopsis thaliana GN=RPL28C PE=2 SV=1 7 141 1.0E-21
sp|Q962T2|RL28_SPOFR 60S ribosomal protein L28 OS=Spodoptera frugiperda GN=RpL28 PE=2 SV=1 9 135 1.0E-18
sp|Q9VZS5|RL28_DROME 60S ribosomal protein L28 OS=Drosophila melanogaster GN=RpL28 PE=1 SV=1 10 136 4.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14069|RL28E_SCHPO Probable 60S ribosomal protein L28e OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl44 PE=1 SV=1 9 137 6.0E-29
sp|O82204|RL281_ARATH 60S ribosomal protein L28-1 OS=Arabidopsis thaliana GN=RPL28A PE=2 SV=1 7 145 2.0E-22
sp|Q9M0E2|RL282_ARATH 60S ribosomal protein L28-2 OS=Arabidopsis thaliana GN=RPL28C PE=2 SV=1 7 141 1.0E-21
sp|Q962T2|RL28_SPOFR 60S ribosomal protein L28 OS=Spodoptera frugiperda GN=RpL28 PE=2 SV=1 9 135 1.0E-18
sp|Q9VZS5|RL28_DROME 60S ribosomal protein L28 OS=Drosophila melanogaster GN=RpL28 PE=1 SV=1 10 136 4.0E-16
sp|Q3T0L7|RL28_BOVIN 60S ribosomal protein L28 OS=Bos taurus GN=RPL28 PE=2 SV=3 9 142 5.0E-14
sp|P41105|RL28_MOUSE 60S ribosomal protein L28 OS=Mus musculus GN=Rpl28 PE=1 SV=2 9 136 8.0E-14
sp|P46779|RL28_HUMAN 60S ribosomal protein L28 OS=Homo sapiens GN=RPL28 PE=1 SV=3 9 136 1.0E-13
sp|P17702|RL28_RAT 60S ribosomal protein L28 OS=Rattus norvegicus GN=Rpl28 PE=1 SV=4 9 136 1.0E-12
sp|Q9GS21|RL28_DICDI 60S ribosomal protein L28 OS=Dictyostelium discoideum GN=rpl28 PE=2 SV=1 9 134 1.0E-09
sp|O00822|RL28_TRYCR 60S ribosomal protein L28 OS=Trypanosoma cruzi PE=2 SV=2 10 125 6.0E-09
sp|Q21930|RL28_CAEEL 60S ribosomal protein L28 OS=Caenorhabditis elegans GN=rpl-28 PE=1 SV=3 9 73 7.0E-07
sp|P0DJ20|RL28_TETTH 60S ribosomal protein L28 OS=Tetrahymena thermophila GN=RPL28 PE=1 SV=1 11 69 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3136
MAPIQHSNVSSDMIWEVVRDNHCFLVKSKRNGGVQFSRDPLNLTNKNSRKHAGFVNDKAIGIVPHEKGGVTVTSK
KTNCANKPTGLLNKVTFGGHRPTRKTYRAVANQAAKRGYRADLRSAAVERISAIRRSQRPAKPAPEPKLRGNKAK
KAAEVS*
Coding >Ophun1|3136
ATGGCGCCCATCCAACATTCGAATGTGTCTTCGGACATGATCTGGGAGGTTGTCCGCGACAACCACTGCTTTCTC
GTCAAGAGCAAGCGCAACGGCGGCGTCCAATTCTCGCGGGATCCCCTGAATTTGACCAACAAGAACAGCCGGAAG
CACGCCGGATTTGTAAACGACAAGGCCATTGGAATTGTTCCCCACGAGAAGGGCGGCGTCACCGTCACCTCGAAG
AAGACGAACTGCGCCAACAAGCCGACCGGGCTTCTCAACAAGGTCACCTTTGGCGGCCACAGGCCTACGCGGAAG
ACCTACAGGGCCGTTGCCAACCAGGCCGCCAAGCGCGGCTACCGCGCCGACCTTCGATCTGCTGCCGTGGAGCGC
ATCTCGGCCATCCGCCGATCTCAGCGGCCCGCCAAGCCGGCACCGGAGCCGAAGCTACGGGGCAACAAGGCCAAG
AAGGCGGCCGAGGTGTCGTGA
Transcript >Ophun1|3136
ATGGCGCCCATCCAACATTCGAATGTGTCTTCGGACATGATCTGGGAGGTTGTCCGCGACAACCACTGCTTTCTC
GTCAAGAGCAAGCGCAACGGCGGCGTCCAATTCTCGCGGGATCCCCTGAATTTGACCAACAAGAACAGCCGGAAG
CACGCCGGATTTGTAAACGACAAGGCCATTGGAATTGTTCCCCACGAGAAGGGCGGCGTCACCGTCACCTCGAAG
AAGACGAACTGCGCCAACAAGCCGACCGGGCTTCTCAACAAGGTCACCTTTGGCGGCCACAGGCCTACGCGGAAG
ACCTACAGGGCCGTTGCCAACCAGGCCGCCAAGCGCGGCTACCGCGCCGACCTTCGATCTGCTGCCGTGGAGCGC
ATCTCGGCCATCCGCCGATCTCAGCGGCCCGCCAAGCCGGCACCGGAGCCGAAGCTACGGGGCAACAAGGCCAAG
AAGGCGGCCGAGGTGTCGTGA
Gene >Ophun1|3136
ATGGCGCCCATCCAACATTCGAATGTGTCTTCGGACATGATCTGGGAGGTTGTCCGTGAGTTTTTATCGGAGGAA
GCATTTTCAAAGGGGAATTGCTCACGAGTGGCCAGGCGACAACCACTGCTTTCTCGTCAAGAGCAAGCGCAACGG
CGGCGTCCAATTCTCGCGGGATCCCCTGAATTTGACCAACAAGAACAGCCGGAAGGTGTGTTTGGAACGGCAATG
GTGCTACGGACCTTTGTGTGCTGACAGGCTGTACAGCACGCCGGATTTGTAAACGACAAGGTGCGACGAACCAAA
ACTCGTTGGAGCGAGGAGCTTACCTTTGAACCGGCAGGCCATTGGAATTGTTCCCCACGAGAAGGGCGGCGTCAC
CGTCACCTCGAAGAAGACGAACTGCGCCAACAAGCCGACCGGGCTTCTCAACAAGGTCACCTTTGGCGGCCACAG
GCCTACGCGGAAGTGAGTCGGCCACGTCTCGTTGCGACTTCGACACGTCTGCTGACGCTGGCTTGCTACGAATTC
AGGACCTACAGGGCCGTTGCCAACCAGGCCGCCAAGCGCGGCTACCGCGCCGACCTTCGATCTGCTGCCGTGGAG
CGCATCTCGGCCATCCGCCGATCTCAGCGGCCCGCCAAGCCGGCACCGGAGCCGAAGCTACGGGGCAACAAGGCC
AAGAAGGCGGCCGAGGTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail