Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3134
Gene name
LocationContig_28:19504..20290
Strand+
Gene length (bp)786
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04051 TRAPP Transport protein particle (TRAPP) component 1.4E-42 19 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86SZ2|TPC6B_HUMAN Trafficking protein particle complex subunit 6B OS=Homo sapiens GN=TRAPPC6B PE=1 SV=1 59 174 2.0E-39
sp|Q32L78|TPC6B_BOVIN Trafficking protein particle complex subunit 6B OS=Bos taurus GN=TRAPPC6B PE=2 SV=1 59 174 2.0E-39
sp|Q9D289|TPC6B_MOUSE Trafficking protein particle complex subunit 6B OS=Mus musculus GN=Trappc6b PE=1 SV=1 59 174 2.0E-38
sp|Q09784|YA95_SCHPO Uncharacterized protein C13G6.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.05c PE=1 SV=3 14 178 1.0E-30
sp|Q3T086|TPC6A_BOVIN Trafficking protein particle complex subunit 6A OS=Bos taurus GN=TRAPPC6A PE=2 SV=1 58 174 2.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86SZ2|TPC6B_HUMAN Trafficking protein particle complex subunit 6B OS=Homo sapiens GN=TRAPPC6B PE=1 SV=1 59 174 2.0E-39
sp|Q32L78|TPC6B_BOVIN Trafficking protein particle complex subunit 6B OS=Bos taurus GN=TRAPPC6B PE=2 SV=1 59 174 2.0E-39
sp|Q9D289|TPC6B_MOUSE Trafficking protein particle complex subunit 6B OS=Mus musculus GN=Trappc6b PE=1 SV=1 59 174 2.0E-38
sp|Q09784|YA95_SCHPO Uncharacterized protein C13G6.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13G6.05c PE=1 SV=3 14 178 1.0E-30
sp|Q3T086|TPC6A_BOVIN Trafficking protein particle complex subunit 6A OS=Bos taurus GN=TRAPPC6A PE=2 SV=1 58 174 2.0E-29
sp|O75865|TPC6A_HUMAN Trafficking protein particle complex subunit 6A OS=Homo sapiens GN=TRAPPC6A PE=1 SV=2 60 174 2.0E-28
sp|Q78XR0|TPC6A_MOUSE Trafficking protein particle complex subunit 6A OS=Mus musculus GN=Trappc6a PE=1 SV=1 60 174 8.0E-28
sp|Q99394|TRS33_YEAST Trafficking protein particle complex subunit 33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS33 PE=1 SV=1 45 168 1.0E-22
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3134
MPPYNASDPTATFLSASALDFLLIEMVPLAQRVAASTLRPSTTTADEDEDVVVDAVHLRLELLGYRVGVGLVERP
RFNDALDIIKFLCKDLWSLLFGKNIDNLKTNHRGVYVLTDNMFRPFSRMSTEAGGQAVARAQPFLWFPCGIVRGA
LAALGMETIVQAEINDLPGAVFQIKTIPAKA*
Coding >Ophun1|3134
ATGCCCCCCTACAACGCCTCCGACCCAACCGCAACCTTCCTCTCAGCCTCAGCCCTCGACTTCCTCCTCATCGAG
ATGGTTCCCCTCGCCCAACGCGTCGCCGCCTCCACCCTGCGCCCCTCCACCACCACCGCGGACGAGGACGAGGAT
GTCGTCGTCGACGCCGTGCATCTCCGTCTTGAGCTCTTGGGGTATAGAGTTGGCGTTGGGCTTGTTGAGCGACCC
CGGTTCAACGACGCGCTCGACATCATTAAATTCCTCTGCAAGGATCTATGGTCCCTCCTCTTCGGCAAGAATATC
GATAACCTCAAGACCAACCATCGCGGCGTCTACGTCCTAACAGACAACATGTTCCGCCCCTTCTCCAGAATGAGT
ACCGAAGCAGGCGGACAGGCCGTCGCTCGAGCTCAGCCTTTCCTCTGGTTTCCCTGTGGCATCGTTCGAGGCGCC
CTGGCGGCATTGGGCATGGAGACCATCGTCCAAGCAGAGATCAACGATCTGCCAGGCGCCGTCTTTCAAATAAAG
ACGATTCCCGCCAAGGCCTGA
Transcript >Ophun1|3134
ATGCCCCCCTACAACGCCTCCGACCCAACCGCAACCTTCCTCTCAGCCTCAGCCCTCGACTTCCTCCTCATCGAG
ATGGTTCCCCTCGCCCAACGCGTCGCCGCCTCCACCCTGCGCCCCTCCACCACCACCGCGGACGAGGACGAGGAT
GTCGTCGTCGACGCCGTGCATCTCCGTCTTGAGCTCTTGGGGTATAGAGTTGGCGTTGGGCTTGTTGAGCGACCC
CGGTTCAACGACGCGCTCGACATCATTAAATTCCTCTGCAAGGATCTATGGTCCCTCCTCTTCGGCAAGAATATC
GATAACCTCAAGACCAACCATCGCGGCGTCTACGTCCTAACAGACAACATGTTCCGCCCCTTCTCCAGAATGAGT
ACCGAAGCAGGCGGACAGGCCGTCGCTCGAGCTCAGCCTTTCCTCTGGTTTCCCTGTGGCATCGTTCGAGGCGCC
CTGGCGGCATTGGGCATGGAGACCATCGTCCAAGCAGAGATCAACGATCTGCCAGGCGCCGTCTTTCAAATAAAG
ACGATTCCCGCCAAGGCCTGA
Gene >Ophun1|3134
ATGCCCCCCTACAACGCCTCCGACCCAACCGCAACCTTCCTCTCAGCCTCAGCCCTCGACTTCCTCCTCATCGAG
ATGGTTCCCCTCGCCCAACGCGTCGCCGCCTCCACCCTGCGCCCCTCCACCACCACCGCGGACGAGGACGAGGAT
GTCGTCGTCGACGCCGTGCATCTCCGTCTTGAGCTCTTGGGGTATAGAGTTGGCGTTGGGCTTGTTGAGCGGTTC
GTTGTTTTTTTTTTTTTGTTGTTTCTTTCCTGCCTTGCCCTTTGGCGCGTGAGAGGGGGGGGTTGGGGGGCTAAG
GGGGTGTAGATTCTCGAGGGATAGACCCCGGTTCAACGACGCGCTCGACATCATTAAATTCCTCTGCAAGGATCT
ATGGTCCCTCCTCTTCGGCAAGAATATCGATAACCTCAAGACCAACCATCGCGTACCTCTCCCCTCTCTCTTCCC
CTTCCCCTTCCCATTCCCATTCCTCGCTTACAAACTTGACAGGGCGTCTACGTCCTAACAGACAACATGTTCCGC
CCCTTCTCCAGAATGAGTACCGAAGCAGGCGGACAGGCCGTCGCTCGAGCTCAGCCTGTACGTTCATCTCCTGTC
CGATACTTCCGTCTTCGTCTGTGCAAGTCGAATCCTCACGCCTGCTTTTCTCAGTTCCTCTGGTTTCCCTGTGGC
ATCGTTCGAGGCGCCCTGGCGGCATTGGGCATGGAGACCATCGTCCAAGCAGAGATCAACGATCTGCCAGGCGCC
GTCTTTCAAATAAAGACGATTCCCGCCAAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail