Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3133
Gene name
LocationContig_28:17125..19024
Strand+
Gene length (bp)1899
Transcript length (bp)1659
Coding sequence length (bp)1659
Protein length (aa) 553

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14324 PINIT PINIT domain 1.4E-40 151 308
PF02891 zf-MIZ MIZ/SP-RING zinc finger 1.0E-21 350 399

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 11 520 4.0E-54
sp|Q04195|SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIZ1 PE=1 SV=1 11 528 1.0E-34
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 24 438 2.0E-34
sp|Q6AZ28|PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus GN=Pias2 PE=1 SV=1 198 433 2.0E-27
sp|O75928|PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens GN=PIAS2 PE=1 SV=3 198 433 4.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94451|PLI1_SCHPO E3 SUMO-protein ligase pli1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pli1 PE=1 SV=3 11 520 4.0E-54
sp|Q04195|SIZ1_YEAST E3 SUMO-protein ligase SIZ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIZ1 PE=1 SV=1 11 528 1.0E-34
sp|Q12216|SIZ2_YEAST E3 SUMO-protein ligase SIZ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFI1 PE=1 SV=1 24 438 2.0E-34
sp|Q6AZ28|PIAS2_RAT E3 SUMO-protein ligase PIAS2 OS=Rattus norvegicus GN=Pias2 PE=1 SV=1 198 433 2.0E-27
sp|O75928|PIAS2_HUMAN E3 SUMO-protein ligase PIAS2 OS=Homo sapiens GN=PIAS2 PE=1 SV=3 198 433 4.0E-27
sp|Q8C5D8|PIAS2_MOUSE E3 SUMO-protein ligase PIAS2 OS=Mus musculus GN=Pias2 PE=1 SV=2 198 433 5.0E-27
sp|O54714|PIAS3_MOUSE E3 SUMO-protein ligase PIAS3 OS=Mus musculus GN=Pias3 PE=1 SV=3 134 456 6.0E-27
sp|O70260|PIAS3_RAT E3 SUMO-protein ligase PIAS3 OS=Rattus norvegicus GN=Pias3 PE=1 SV=2 134 456 6.0E-27
sp|O88907|PIAS1_MOUSE E3 SUMO-protein ligase PIAS1 OS=Mus musculus GN=Pias1 PE=1 SV=2 207 433 3.0E-26
sp|Q9Y6X2|PIAS3_HUMAN E3 SUMO-protein ligase PIAS3 OS=Homo sapiens GN=PIAS3 PE=1 SV=2 134 456 3.0E-26
sp|O75925|PIAS1_HUMAN E3 SUMO-protein ligase PIAS1 OS=Homo sapiens GN=PIAS1 PE=1 SV=2 207 433 4.0E-26
sp|Q8N2W9|PIAS4_HUMAN E3 SUMO-protein ligase PIAS4 OS=Homo sapiens GN=PIAS4 PE=1 SV=1 204 451 7.0E-26
sp|Q9JM05|PIAS4_MOUSE E3 SUMO-protein ligase PIAS4 OS=Mus musculus GN=Pias4 PE=1 SV=2 204 448 1.0E-24
sp|Q8NF64|ZMIZ2_HUMAN Zinc finger MIZ domain-containing protein 2 OS=Homo sapiens GN=ZMIZ2 PE=1 SV=2 300 434 5.0E-17
sp|Q8CIE2|ZMIZ2_MOUSE Zinc finger MIZ domain-containing protein 2 OS=Mus musculus GN=Zmiz2 PE=2 SV=2 300 434 6.0E-17
sp|Q6P1E1|ZMIZ1_MOUSE Zinc finger MIZ domain-containing protein 1 OS=Mus musculus GN=Zmiz1 PE=2 SV=1 300 434 6.0E-17
sp|Q9ULJ6|ZMIZ1_HUMAN Zinc finger MIZ domain-containing protein 1 OS=Homo sapiens GN=ZMIZ1 PE=1 SV=3 300 434 6.0E-17
sp|Q94361|GEI17_CAEEL E3 SUMO-protein ligase gei-17 OS=Caenorhabditis elegans GN=gei-17 PE=1 SV=4 247 435 6.0E-16
sp|A0A0A7EPL0|PIAL1_ARATH E4 SUMO-protein ligase PIAL1 OS=Arabidopsis thaliana GN=PIAL1 PE=2 SV=1 327 441 8.0E-15
sp|Q6L4L4|SIZ1_ORYSJ E3 SUMO-protein ligase SIZ1 OS=Oryza sativa subsp. japonica GN=SIZ1 PE=1 SV=1 340 435 1.0E-14
sp|F4JYG0|PIAL2_ARATH E4 SUMO-protein ligase PIAL2 OS=Arabidopsis thaliana GN=PIAL2 PE=1 SV=1 340 435 2.0E-14
sp|Q6ASW7|SIZ2_ORYSJ E3 SUMO-protein ligase SIZ2 OS=Oryza sativa subsp. japonica GN=SIZ2 PE=2 SV=1 340 435 2.0E-13
sp|Q680Q4|SIZ1_ARATH E3 SUMO-protein ligase SIZ1 OS=Arabidopsis thaliana GN=SIZ1 PE=1 SV=2 340 446 7.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Zinc finger, MIZ-type

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3567
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|279
Ophiocordyceps australis map64 (Brazil) OphauB2|7142
Ophiocordyceps camponoti-floridani Ophcf2|06033
Ophiocordyceps camponoti-rufipedis Ophun1|3133 (this protein)
Ophiocordyceps kimflemingae Ophio5|5883
Ophiocordyceps subramaniannii Hirsu2|6850

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3133
MASSVSSISRQEVSTLMRQIQSNQLYNRQLSSICQINGLKSTGVKIELQNRIVGLIQEAVNANDAARFCQVRQSI
INAIAQRGSPAKMPARHTNSTPSHSSLATQYSPTASSYSPGTISYQQQGYNVAASTTPNRHLPMPQYPTSTMSST
LTFRPSPFYRIEDHVSTLRVCEVMTAHRHSISIPLELNECPALQRCLGDRSYRVMIFCSSEATGVQNITFPYQSE
LKVNGSDIKANMRGLKNKPGSTRPVDITNALRLRPGHVNNIEFTYALTNKVGHSISSSVLLESLPLTGKRAVQKF
YLIANLCKVTTVSELESIVSNRLTIPKETVVAELNKIAQDPDVVATSQILSLKCPLSYMRLEIPCRSLSCIHIQC
FDATSYLQLQEQGPQWTCPICNKPAPFDQLAVDNYVKDILDNTPKDLESVTIEPNGRWRVHSSQDDQTNALEGSA
FGDDDLVEISETIAHGGGRKMETPRNATPNIRTPVSNGSTSMPRGAATFSAKRPASAVIDLTEDSDEESVRAPHK
RQNTGANGGCNGFAGSYLGESPVGYSS*
Coding >Ophun1|3133
ATGGCTTCGTCGGTGTCTTCCATCTCGCGGCAGGAGGTATCAACTCTGATGCGGCAGATTCAGAGTAATCAACTC
TACAATCGCCAGCTTTCGTCCATTTGCCAGATCAACGGCCTGAAAAGCACCGGCGTCAAAATCGAGTTACAGAAC
CGCATTGTTGGTCTCATTCAAGAAGCAGTCAACGCCAACGACGCCGCGCGTTTCTGCCAAGTCCGCCAGAGCATC
ATCAACGCCATCGCGCAGCGCGGAAGTCCTGCCAAGATGCCTGCCCGACACACCAACTCGACGCCCTCACACTCG
TCTCTGGCGACGCAGTACTCGCCCACAGCCTCTTCCTACAGCCCCGGCACCATCTCGTACCAGCAACAGGGCTAC
AACGTCGCGGCCTCGACGACTCCTAACCGCCATCTTCCCATGCCTCAATATCCCACCTCCACCATGTCTTCCACT
TTGACATTTCGTCCCAGCCCCTTCTACCGCATCGAAGATCACGTCAGCACCTTGCGTGTTTGTGAAGTCATGACG
GCGCATAGGCACTCGATCAGCATACCCTTGGAGCTCAACGAGTGCCCCGCTCTTCAACGATGTCTCGGGGACAGG
TCCTACCGCGTCATGATCTTCTGTTCCTCCGAGGCTACTGGTGTGCAGAACATTACGTTTCCCTACCAGTCCGAG
CTCAAGGTCAACGGCAGCGACATCAAGGCCAACATGCGCGGGCTCAAGAACAAGCCGGGCTCGACCCGACCGGTT
GATATCACAAATGCTCTTCGCCTCAGACCCGGTCACGTAAACAATATCGAGTTTACATATGCCTTGACGAACAAG
GTAGGCCATTCCATCTCCAGTTCCGTCCTTCTCGAGAGCCTGCCGCTCACCGGCAAGCGGGCGGTGCAGAAATTT
TACCTCATAGCAAATCTCTGCAAAGTCACGACGGTCTCCGAACTGGAGTCCATCGTCTCAAACCGCCTGACAATA
CCGAAAGAGACTGTTGTCGCAGAATTGAACAAGATTGCCCAGGACCCCGATGTCGTGGCGACGTCACAGATCTTG
TCTCTGAAGTGCCCTCTCTCGTACATGAGGCTGGAGATACCCTGTCGTAGCCTGAGCTGCATTCACATTCAATGT
TTTGATGCGACTTCTTACCTTCAGCTCCAGGAACAAGGGCCGCAGTGGACATGCCCCATTTGCAACAAGCCGGCG
CCTTTTGACCAGCTCGCCGTCGACAATTACGTCAAGGACATTCTCGACAACACGCCCAAGGATTTGGAGTCGGTG
ACGATTGAGCCCAACGGTAGATGGCGTGTCCATTCGTCGCAAGATGATCAGACGAACGCCCTCGAGGGATCGGCA
TTCGGCGACGATGACCTAGTGGAAATCTCCGAGACGATTGCCCACGGCGGCGGACGCAAGATGGAAACTCCGAGG
AACGCGACGCCCAACATCAGGACGCCCGTGTCCAACGGTTCGACGAGCATGCCCCGAGGCGCCGCCACGTTCAGC
GCCAAGCGGCCAGCCTCGGCGGTGATTGACCTGACGGAAGACTCGGACGAGGAGTCGGTGCGAGCGCCACACAAG
AGACAAAACACAGGAGCGAATGGCGGATGTAACGGTTTCGCCGGGAGTTACCTCGGCGAGTCTCCTGTCGGTTAC
TCGTCGTGA
Transcript >Ophun1|3133
ATGGCTTCGTCGGTGTCTTCCATCTCGCGGCAGGAGGTATCAACTCTGATGCGGCAGATTCAGAGTAATCAACTC
TACAATCGCCAGCTTTCGTCCATTTGCCAGATCAACGGCCTGAAAAGCACCGGCGTCAAAATCGAGTTACAGAAC
CGCATTGTTGGTCTCATTCAAGAAGCAGTCAACGCCAACGACGCCGCGCGTTTCTGCCAAGTCCGCCAGAGCATC
ATCAACGCCATCGCGCAGCGCGGAAGTCCTGCCAAGATGCCTGCCCGACACACCAACTCGACGCCCTCACACTCG
TCTCTGGCGACGCAGTACTCGCCCACAGCCTCTTCCTACAGCCCCGGCACCATCTCGTACCAGCAACAGGGCTAC
AACGTCGCGGCCTCGACGACTCCTAACCGCCATCTTCCCATGCCTCAATATCCCACCTCCACCATGTCTTCCACT
TTGACATTTCGTCCCAGCCCCTTCTACCGCATCGAAGATCACGTCAGCACCTTGCGTGTTTGTGAAGTCATGACG
GCGCATAGGCACTCGATCAGCATACCCTTGGAGCTCAACGAGTGCCCCGCTCTTCAACGATGTCTCGGGGACAGG
TCCTACCGCGTCATGATCTTCTGTTCCTCCGAGGCTACTGGTGTGCAGAACATTACGTTTCCCTACCAGTCCGAG
CTCAAGGTCAACGGCAGCGACATCAAGGCCAACATGCGCGGGCTCAAGAACAAGCCGGGCTCGACCCGACCGGTT
GATATCACAAATGCTCTTCGCCTCAGACCCGGTCACGTAAACAATATCGAGTTTACATATGCCTTGACGAACAAG
GTAGGCCATTCCATCTCCAGTTCCGTCCTTCTCGAGAGCCTGCCGCTCACCGGCAAGCGGGCGGTGCAGAAATTT
TACCTCATAGCAAATCTCTGCAAAGTCACGACGGTCTCCGAACTGGAGTCCATCGTCTCAAACCGCCTGACAATA
CCGAAAGAGACTGTTGTCGCAGAATTGAACAAGATTGCCCAGGACCCCGATGTCGTGGCGACGTCACAGATCTTG
TCTCTGAAGTGCCCTCTCTCGTACATGAGGCTGGAGATACCCTGTCGTAGCCTGAGCTGCATTCACATTCAATGT
TTTGATGCGACTTCTTACCTTCAGCTCCAGGAACAAGGGCCGCAGTGGACATGCCCCATTTGCAACAAGCCGGCG
CCTTTTGACCAGCTCGCCGTCGACAATTACGTCAAGGACATTCTCGACAACACGCCCAAGGATTTGGAGTCGGTG
ACGATTGAGCCCAACGGTAGATGGCGTGTCCATTCGTCGCAAGATGATCAGACGAACGCCCTCGAGGGATCGGCA
TTCGGCGACGATGACCTAGTGGAAATCTCCGAGACGATTGCCCACGGCGGCGGACGCAAGATGGAAACTCCGAGG
AACGCGACGCCCAACATCAGGACGCCCGTGTCCAACGGTTCGACGAGCATGCCCCGAGGCGCCGCCACGTTCAGC
GCCAAGCGGCCAGCCTCGGCGGTGATTGACCTGACGGAAGACTCGGACGAGGAGTCGGTGCGAGCGCCACACAAG
AGACAAAACACAGGAGCGAATGGCGGATGTAACGGTTTCGCCGGGAGTTACCTCGGCGAGTCTCCTGTCGGTTAC
TCGTCGTGA
Gene >Ophun1|3133
ATGGCTTCGTCGGTGTCTTCCATCTCGCGGCAGGAGGTATCAACTCTGATGCGGCAGATTCAGAGTAATCAACTC
TACAATCGCCAGCTTTCGTCCATTTGCCAGATCAACGGCCTGAAAAGCACCGGCGTCAAAATCGAGTTACAGAAC
CGCATTGTTGGTCGTGAGTTTTCTTCTTTTGGGGATTGTCCTTGTTGCACAACCCCCAATCTTATCGGAAATCTC
TTCATCTAACGCGTTTTCCCAGTCATTCAAGAAGCAGTCAACGCCAACGACGCCGCGCGTTTCTGCCAAGTCCGC
CAGAGCATCATCAACGCCATCGCGCAGCGCGGAAGTCCTGCCAAGATGCCTGCCCGACACACCAACTCGACGCCC
TCACACTCGTCTCTGGCGACGCAGTACTCGCCCACAGCCTCTTCCTACAGCCCCGGCACCATCTCGTACCAGCAA
CAGGGCTACAACGTCGCGGCCTCGACGACTCCTAACCGCCATCTTCCCATGCCTCAATATCCCACCTCCACCATG
TCTTCCACTTTGACATTTCGTCCCAGCCCCTTCTACCGCATCGAAGATCACGTCAGCACCTTGCGTGTTTGTGAA
GGTCAGCCTGCGTCGTTGCTTGGTCAGACGTCTACTAACGCCGCCTCTTCAGTCATGACGGCGCATAGGCACTCG
ATCAGCATACCCTTGGAGCTCAACGAGTGCCCCGCTCTTCAACGATGTCTCGGGGACAGGTCCTACCGCGTCATG
ATCTTCTGTTCCTCCGAGGCTACTGGTGTGCAGAACATTACGTTTCCCTACCAGTCCGAGCTCAAGGTCAACGGC
AGCGACATCAAGGCCAACATGCGCGGGCTCAAGAACAAGCCGGGCTCGACCCGACCGGTTGATATCACAAATGCT
CTTCGCCTCAGACCCGGTCACGTAAACAATATCGAGTTTACATATGCCTTGACGAACAAGGTAGGCCATTCCATC
TCCAGTTCCGTCCTTCTCGAGAGCCTGCCGCTCACCGGCAAGCGGGCGGTGCAGAAATTTTACCTCATAGCAAAT
CTCTGCAAAGTCACGACGGTCTCCGAACTGGAGTCCATCGTCTCAAACCGCCTGACAATACCGAAAGAGACTGTT
GTCGCAGAATGTGAGTCAACATGCCCGAGCTTTGATGCGACCCGCTGACACGCAGCTAGTGAACAAGATTGCCCA
GGACCCCGATGTCGTGGCGACGTCACAGATCTTGTCTCTGAAGTGCCCTCTCTCGTACATGAGGCTGGAGATACC
CTGTCGTAGCCTGAGCTGCATTCACATTCAATGTTTTGATGCGACTTCTTACCTTCAGCTCCAGGAACAAGGGCC
GCAGTGGACATGCCCCATTTGCAACAAGCCGGCGCCTTTTGACCAGCTCGCCGTCGACAAGTAAGTCCAAGTTTG
CCCCGCTGCCATGTGTCGTGTGTCGCTAACAGGCTGGTCAGTTACGTCAAGGACATTCTCGACAACACGCCCAAG
GATTTGGAGTCGGTGACGATTGAGCCCAACGGTAGATGGCGTGTCCATTCGTCGCAAGATGATCAGACGAACGCC
CTCGAGGGATCGGCATTCGGCGACGATGACCTAGTGGAAATCTCCGAGACGATTGCCCACGGCGGCGGACGCAAG
ATGGAAACTCCGAGGAACGCGACGCCCAACATCAGGACGCCCGTGTCCAACGGTTCGACGAGCATGCCCCGAGGC
GCCGCCACGTTCAGCGCCAAGCGGCCAGCCTCGGCGGTGATTGACCTGACGGAAGACTCGGACGAGGAGTCGGTG
CGAGCGCCACACAAGAGACAAAACACAGGAGCGAATGGCGGATGTAACGGTTTCGCCGGGAGTTACCTCGGCGAG
TCTCCTGTCGGTTACTCGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail