Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3131
Gene name
LocationContig_28:12429..15322
Strand-
Gene length (bp)2893
Transcript length (bp)2592
Coding sequence length (bp)2592
Protein length (aa) 864

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19316 PIGO_PIGG GPI ethanolamine phosphate transferase membrane region 1.4E-158 444 862
PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase 2.0E-09 203 277

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 18 851 0.0E+00
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 18 851 0.0E+00
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 15 863 9.0E-157
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 24 855 2.0E-149
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 28 851 1.0E-145
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U9J2|GPI7_ASPOR GPI ethanolamine phosphate transferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=las21 PE=3 SV=2 18 851 0.0E+00
sp|Q4WDM5|GPI7_ASPFU GPI ethanolamine phosphate transferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=las21 PE=2 SV=1 18 851 0.0E+00
sp|Q6C7Q6|GPI7_YARLI GPI ethanolamine phosphate transferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=LAS21 PE=3 SV=1 15 863 9.0E-157
sp|Q8TGB2|GPI7_CANAL GPI ethanolamine phosphate transferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LAS21 PE=3 SV=2 24 855 2.0E-149
sp|Q6BZ57|GPI7_DEBHA GPI ethanolamine phosphate transferase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=LAS21 PE=3 SV=2 28 851 1.0E-145
sp|Q758B8|GPI7_ASHGO GPI ethanolamine phosphate transferase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LAS21 PE=3 SV=2 24 862 2.0E-142
sp|Q6CLN2|GPI7_KLULA GPI ethanolamine phosphate transferase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAS21 PE=3 SV=1 12 860 7.0E-130
sp|Q6FPB2|GPI7_CANGA GPI ethanolamine phosphate transferase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LAS21 PE=3 SV=1 24 843 3.0E-125
sp|P40367|GPI7_YEAST GPI ethanolamine phosphate transferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LAS21 PE=1 SV=1 12 849 5.0E-124
sp|Q09782|GPI7_SCHPO GPI ethanolamine phosphate transferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=las21 PE=3 SV=1 27 847 8.0E-113
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 24 348 6.0E-63
sp|O13663|GPI13_SCHPO GPI ethanolamine phosphate transferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi13 PE=3 SV=1 7 362 5.0E-38
sp|Q8TEQ8|PIGO_HUMAN GPI ethanolamine phosphate transferase 3 OS=Homo sapiens GN=PIGO PE=1 SV=3 60 352 1.0E-37
sp|Q74ZS2|GPI13_ASHGO GPI ethanolamine phosphate transferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI13 PE=3 SV=2 12 379 4.0E-36
sp|Q07830|GPI13_YEAST GPI ethanolamine phosphate transferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI13 PE=1 SV=1 24 345 6.0E-36
sp|Q9JJI6|PIGO_MOUSE GPI ethanolamine phosphate transferase 3 OS=Mus musculus GN=Pigo PE=1 SV=2 104 352 2.0E-34
sp|P36051|MCD4_YEAST GPI ethanolamine phosphate transferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCD4 PE=1 SV=1 38 388 2.0E-13
sp|Q5H8A4|PIGG_HUMAN GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1 538 837 7.0E-12
sp|Q6CW36|MCD4_KLULA GPI ethanolamine phosphate transferase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MCD4 PE=3 SV=1 38 373 1.0E-11
sp|Q9R1S3|PIGN_MOUSE GPI ethanolamine phosphate transferase 1 OS=Mus musculus GN=Pign PE=2 SV=2 20 345 3.0E-10
sp|O95427|PIGN_HUMAN GPI ethanolamine phosphate transferase 1 OS=Homo sapiens GN=PIGN PE=1 SV=1 218 377 4.0E-10
sp|Q6C0Z3|MCD4_YARLI GPI ethanolamine phosphate transferase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MCD4 PE=3 SV=1 38 368 4.0E-10
sp|Q6FJ81|MCD4_CANGA GPI ethanolamine phosphate transferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MCD4 PE=3 SV=1 210 417 1.0E-09
sp|Q2H0X9|MCD4_CHAGB GPI ethanolamine phosphate transferase 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MCD4 PE=3 SV=1 193 373 2.0E-09
sp|Q4ILH3|MCD4_GIBZE GPI ethanolamine phosphate transferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCD4 PE=3 SV=1 210 373 8.0E-09
sp|Q5AXD1|MCD4_EMENI GPI ethanolamine phosphate transferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mcd4 PE=3 SV=1 210 345 2.0E-08
sp|Q2U0S9|MCD4_ASPOR GPI ethanolamine phosphate transferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mcd4 PE=3 SV=1 38 377 2.0E-08
sp|Q7SAP1|MCD4_NEUCR GPI ethanolamine phosphate transferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mcd-4 PE=3 SV=1 193 345 6.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 452 471 19
3 478 500 22
4 565 587 22
5 599 621 22
6 645 664 19
7 801 823 22
8 838 860 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3131
MKAISAKASLPYAILAAANLVLPIAILVFATGFFPRKPILPGLASFESLPEFSSPPSAPFDRLIFMVVDALRRQV
GVWIMTIFRSPADTAAVISLIRNGAAIPFTANARTPTVTMPRIKAMTTGSIPSFVDLILNIDEADTSSSLAHQDS
WLAQLKAADKGKLLMYGDDTWLKLFPNIFDRHDGTSSFFVSDFTEVDHNVTRNIPAELERSDWALMVLHYLGLDH
IGHKAGPRSSNMVPKQREMDGIVETIFKAIESNDHLESTLLVLCGDHGMNDAGNHGASSPGETSAALLFLSPKLR
AISQGLPAPTQPRAEFDYYASVEQSDIAPTLAALLGFPVSKNNLGAFIPDFLPFWSKDSDRLQILLRNAKQMLGI
VKSAFGDRLFDTQGTPDPCRMAATSVNELACDWRRISRGSASPGNVDSVWLSDAAAWLRKAQDLMSSMASNFSTE
KLMYGQIMGTIAVGLVVLAMLTQQTLSGNRYWPVVVISLLYGVMNFASSYVEEEQHFWYWSCSLWTAWLGSRSIR
RTGTLWPAGYHLLALVCLRLARSWNQTGQKFAGEPDIVKLFLAPNPQFTWALVSLAYAMVAFRIAKSLPGLPSVL
RLSLTSALISAAFSFKLAFTAQDAPELVTGLAGKVDQALQGPSLIVRARSVFLLLAVGAVLAVIRGGMGRHLVQP
SARLLHHLYTLFAMTQSRTTNIPLLVLAQTMCHCLEMDDLSLSEVTTSCLLLQHAFFFAFGGSNAISSVDLSSSY
NGFENFNAVAVGSLTFVSNWAGPIFWTSAANLVLLQKQVGSRADVCRRHLMLLTLFVNVSAVSVMVACNALRTHL
FIWTVFSPRYLYVMAWSIAYHLVTNVGLGSLLFVLGAR*
Coding >Ophun1|3131
ATGAAGGCCATTTCCGCCAAGGCGTCCCTGCCATACGCCATACTGGCTGCTGCGAACCTCGTCTTGCCGATAGCC
ATCCTCGTCTTCGCCACTGGCTTCTTCCCCCGCAAGCCAATCCTCCCCGGCCTGGCCAGTTTCGAGTCTCTTCCC
GAGTTTAGTTCTCCGCCGAGCGCCCCGTTCGACCGGCTCATCTTCATGGTTGTTGATGCTTTGAGAAGGCAGGTC
GGCGTTTGGATAATGACCATCTTCCGCAGCCCAGCTGACACTGCGGCAGTGATTTCTCTTATTCGCAATGGAGCC
GCAATCCCCTTCACCGCCAATGCTCGTACTCCTACGGTGACGATGCCCCGGATCAAGGCCATGACCACCGGCTCG
ATTCCTTCATTTGTCGACCTCATTCTAAACATCGACGAGGCCGACACTTCGTCTTCCCTGGCCCATCAGGACTCC
TGGTTGGCGCAGCTCAAAGCTGCAGACAAGGGCAAGCTTCTCATGTACGGAGACGATACCTGGCTCAAGCTATTT
CCGAATATTTTTGATCGTCATGATGGCACCTCGAGCTTCTTCGTTTCCGACTTTACCGAGGTTGATCACAACGTG
ACGAGAAATATACCTGCCGAGCTGGAGCGGTCGGACTGGGCTCTGATGGTGCTGCATTATCTCGGTCTCGATCAC
ATCGGCCACAAGGCCGGTCCCAGAAGCTCCAACATGGTGCCCAAGCAGCGGGAGATGGACGGCATCGTCGAGACC
ATCTTCAAGGCCATCGAGTCCAACGATCATCTGGAGTCGACCCTGCTTGTCTTGTGTGGCGATCACGGCATGAAC
GATGCCGGAAACCACGGAGCCTCATCCCCTGGCGAGACATCGGCGGCCCTTCTCTTCCTGTCCCCCAAGCTGAGG
GCCATATCTCAAGGCTTGCCCGCTCCAACACAGCCTCGGGCCGAGTTCGACTACTACGCGTCTGTTGAGCAGTCT
GACATCGCCCCGACCCTTGCCGCGCTGCTCGGATTCCCTGTGTCCAAAAATAACCTGGGCGCCTTCATACCCGAC
TTTCTGCCATTTTGGTCCAAAGACAGCGATAGGCTTCAGATCCTTCTCCGCAACGCCAAGCAGATGCTCGGCATC
GTCAAATCCGCATTTGGAGACCGTCTTTTCGACACGCAGGGCACTCCCGACCCGTGCCGGATGGCTGCTACCAGC
GTCAACGAGCTTGCCTGCGATTGGCGTCGCATCAGTCGGGGGTCAGCATCCCCGGGCAATGTCGATTCGGTCTGG
CTCTCGGATGCAGCGGCGTGGCTGCGCAAGGCTCAGGATCTGATGAGCAGCATGGCCTCCAATTTCAGCACGGAG
AAGCTGATGTACGGCCAGATAATGGGCACTATAGCCGTGGGATTGGTTGTCCTCGCAATGCTGACGCAACAGACG
CTCTCCGGCAACAGATATTGGCCTGTTGTGGTCATCTCGCTGTTGTATGGCGTCATGAACTTTGCCAGCAGCTAC
GTGGAGGAGGAACAGCACTTTTGGTACTGGTCATGCTCGCTGTGGACGGCCTGGCTCGGCTCGCGCTCCATCCGC
AGAACCGGGACACTGTGGCCCGCTGGCTACCATCTGCTGGCCCTTGTTTGCTTGCGGCTGGCGAGAAGCTGGAAC
CAGACGGGCCAAAAGTTCGCCGGCGAGCCCGACATCGTCAAGCTGTTTCTCGCCCCGAACCCGCAGTTCACCTGG
GCACTCGTCAGCCTGGCTTATGCCATGGTCGCCTTTCGAATTGCAAAAAGCCTGCCTGGTCTCCCGTCCGTCCTC
AGGCTGTCCTTGACATCTGCCCTCATCTCTGCCGCCTTCAGCTTCAAGCTGGCTTTTACAGCACAGGACGCCCCT
GAGTTGGTGACGGGCCTCGCCGGAAAGGTCGACCAGGCATTGCAAGGCCCGTCACTGATAGTCCGGGCGCGGTCC
GTGTTCCTGCTTCTTGCGGTGGGAGCTGTCTTGGCCGTGATTAGAGGAGGCATGGGGCGTCATCTGGTGCAACCA
TCTGCCCGTCTTCTCCACCATCTGTACACCCTGTTCGCCATGACGCAGTCTCGGACAACCAACATCCCTCTCCTC
GTGCTGGCCCAGACCATGTGCCATTGTCTCGAGATGGACGACCTGTCTCTGAGCGAAGTGACGACGTCGTGTCTC
TTGCTGCAACACGCCTTCTTCTTTGCCTTTGGTGGCTCCAACGCCATCTCATCGGTCGACTTGTCCAGCTCGTAC
AATGGCTTTGAGAACTTCAATGCCGTTGCCGTGGGCAGCCTCACTTTCGTCAGCAACTGGGCCGGTCCCATCTTT
TGGACGTCTGCCGCCAACCTTGTGCTTCTGCAGAAACAGGTGGGAAGTCGAGCCGATGTCTGCCGTCGCCATCTG
ATGCTTCTCACTCTGTTCGTCAACGTCAGCGCGGTGTCCGTCATGGTGGCCTGCAACGCGCTGAGGACTCATTTG
TTCATCTGGACCGTCTTCTCGCCGAGGTATCTGTACGTGATGGCGTGGTCGATTGCCTATCATCTTGTGACGAAT
GTCGGACTCGGATCTCTTCTTTTCGTACTGGGCGCAAGGTAA
Transcript >Ophun1|3131
ATGAAGGCCATTTCCGCCAAGGCGTCCCTGCCATACGCCATACTGGCTGCTGCGAACCTCGTCTTGCCGATAGCC
ATCCTCGTCTTCGCCACTGGCTTCTTCCCCCGCAAGCCAATCCTCCCCGGCCTGGCCAGTTTCGAGTCTCTTCCC
GAGTTTAGTTCTCCGCCGAGCGCCCCGTTCGACCGGCTCATCTTCATGGTTGTTGATGCTTTGAGAAGGCAGGTC
GGCGTTTGGATAATGACCATCTTCCGCAGCCCAGCTGACACTGCGGCAGTGATTTCTCTTATTCGCAATGGAGCC
GCAATCCCCTTCACCGCCAATGCTCGTACTCCTACGGTGACGATGCCCCGGATCAAGGCCATGACCACCGGCTCG
ATTCCTTCATTTGTCGACCTCATTCTAAACATCGACGAGGCCGACACTTCGTCTTCCCTGGCCCATCAGGACTCC
TGGTTGGCGCAGCTCAAAGCTGCAGACAAGGGCAAGCTTCTCATGTACGGAGACGATACCTGGCTCAAGCTATTT
CCGAATATTTTTGATCGTCATGATGGCACCTCGAGCTTCTTCGTTTCCGACTTTACCGAGGTTGATCACAACGTG
ACGAGAAATATACCTGCCGAGCTGGAGCGGTCGGACTGGGCTCTGATGGTGCTGCATTATCTCGGTCTCGATCAC
ATCGGCCACAAGGCCGGTCCCAGAAGCTCCAACATGGTGCCCAAGCAGCGGGAGATGGACGGCATCGTCGAGACC
ATCTTCAAGGCCATCGAGTCCAACGATCATCTGGAGTCGACCCTGCTTGTCTTGTGTGGCGATCACGGCATGAAC
GATGCCGGAAACCACGGAGCCTCATCCCCTGGCGAGACATCGGCGGCCCTTCTCTTCCTGTCCCCCAAGCTGAGG
GCCATATCTCAAGGCTTGCCCGCTCCAACACAGCCTCGGGCCGAGTTCGACTACTACGCGTCTGTTGAGCAGTCT
GACATCGCCCCGACCCTTGCCGCGCTGCTCGGATTCCCTGTGTCCAAAAATAACCTGGGCGCCTTCATACCCGAC
TTTCTGCCATTTTGGTCCAAAGACAGCGATAGGCTTCAGATCCTTCTCCGCAACGCCAAGCAGATGCTCGGCATC
GTCAAATCCGCATTTGGAGACCGTCTTTTCGACACGCAGGGCACTCCCGACCCGTGCCGGATGGCTGCTACCAGC
GTCAACGAGCTTGCCTGCGATTGGCGTCGCATCAGTCGGGGGTCAGCATCCCCGGGCAATGTCGATTCGGTCTGG
CTCTCGGATGCAGCGGCGTGGCTGCGCAAGGCTCAGGATCTGATGAGCAGCATGGCCTCCAATTTCAGCACGGAG
AAGCTGATGTACGGCCAGATAATGGGCACTATAGCCGTGGGATTGGTTGTCCTCGCAATGCTGACGCAACAGACG
CTCTCCGGCAACAGATATTGGCCTGTTGTGGTCATCTCGCTGTTGTATGGCGTCATGAACTTTGCCAGCAGCTAC
GTGGAGGAGGAACAGCACTTTTGGTACTGGTCATGCTCGCTGTGGACGGCCTGGCTCGGCTCGCGCTCCATCCGC
AGAACCGGGACACTGTGGCCCGCTGGCTACCATCTGCTGGCCCTTGTTTGCTTGCGGCTGGCGAGAAGCTGGAAC
CAGACGGGCCAAAAGTTCGCCGGCGAGCCCGACATCGTCAAGCTGTTTCTCGCCCCGAACCCGCAGTTCACCTGG
GCACTCGTCAGCCTGGCTTATGCCATGGTCGCCTTTCGAATTGCAAAAAGCCTGCCTGGTCTCCCGTCCGTCCTC
AGGCTGTCCTTGACATCTGCCCTCATCTCTGCCGCCTTCAGCTTCAAGCTGGCTTTTACAGCACAGGACGCCCCT
GAGTTGGTGACGGGCCTCGCCGGAAAGGTCGACCAGGCATTGCAAGGCCCGTCACTGATAGTCCGGGCGCGGTCC
GTGTTCCTGCTTCTTGCGGTGGGAGCTGTCTTGGCCGTGATTAGAGGAGGCATGGGGCGTCATCTGGTGCAACCA
TCTGCCCGTCTTCTCCACCATCTGTACACCCTGTTCGCCATGACGCAGTCTCGGACAACCAACATCCCTCTCCTC
GTGCTGGCCCAGACCATGTGCCATTGTCTCGAGATGGACGACCTGTCTCTGAGCGAAGTGACGACGTCGTGTCTC
TTGCTGCAACACGCCTTCTTCTTTGCCTTTGGTGGCTCCAACGCCATCTCATCGGTCGACTTGTCCAGCTCGTAC
AATGGCTTTGAGAACTTCAATGCCGTTGCCGTGGGCAGCCTCACTTTCGTCAGCAACTGGGCCGGTCCCATCTTT
TGGACGTCTGCCGCCAACCTTGTGCTTCTGCAGAAACAGGTGGGAAGTCGAGCCGATGTCTGCCGTCGCCATCTG
ATGCTTCTCACTCTGTTCGTCAACGTCAGCGCGGTGTCCGTCATGGTGGCCTGCAACGCGCTGAGGACTCATTTG
TTCATCTGGACCGTCTTCTCGCCGAGGTATCTGTACGTGATGGCGTGGTCGATTGCCTATCATCTTGTGACGAAT
GTCGGACTCGGATCTCTTCTTTTCGTACTGGGCGCAAGGTAA
Gene >Ophun1|3131
ATGAAGGCCATTTCCGCCAAGGCGTCCCTGCCATACGCCATACTGGCTGCTGCGAACCTCGTCTTGCCGATAGCC
ATCCTCGTCTTCGCCACTGGCTTCTTCCCCCGCAAGCCAATCCTCCCCGGCCTGGCCAGTTTCGAGTCTCTTCCC
GAGTTTAGTTCTCCGCCGAGCGCCCCGTTCGACCGGCTCATCTTCATGGTTGTTGATGCTTTGAGAAGGCAGGTC
GGCGTTTGGATAATGACCATCTTCCGCAGCCCAGCTGACACTGCGGCAGTGATTTCGTCTACTCGAACCAATCCG
GCTTCCAATACACACAGAGGTTCAGTTTCCACCTGTCTCATCTGCTACACCGCTGACGACCCTTCTTCATAGTCT
TATTCGCAATGGAGCCGCAATCCCCTTCACCGCCAATGCTCGTACTCCTACGGTGACGATGCCCCGGATCAAGGC
CATGACCACCGGCTCGATTCCTTCATTTGTCGACCTCATTCTAAACATCGACGAGGCCGACACTTCGTCTTCCCT
GGCCCATCAGGACTCCTGGTTGGCGCAGCTCAAAGCTGCAGACAAGGGCAAGCTTCTCATGTACGGAGACGATAC
CTGGCTCAAGCTATTTCCGAATATTTTTGATCGTCATGATGGCACCTCGAGCTTCTTCGTTTCCGTACCGTCCCC
TCTTGCCCTCGCCTCCCGCTGCTCACTGACTATTGCGACTCTTGGCCCAGGACTTTACCGAGGTTGATCACAACG
TGACGAGAAATATACCTGCCGAGCTGGAGCGGTCGGACTGGGCTCTGATGGTGCTGCATTATCTCGGTCTCGATC
ACATCGGCCACAAGGCCGGTCCCAGAAGGTATGTACAGAAGTCTCAGGCTGAAACGGTGCTGACTCTGTAACTAG
CTCCAACATGGTGCCCAAGCAGCGGGAGATGGACGGCATCGTCGAGACCATCTTCAAGGCCATCGAGTCCAACGA
TCATCTGGAGTCGACCCTGCTTGTCTTGTGTGGCGATCACGGCATGAACGATGCCGGAAACCACGGAGCCTCATC
CCCTGGCGAGACATCGGCGGCCCTTCTCTTCCTGTCCCCCAAGCTGAGGGCCATATCTCAAGGCTTGCCCGCTCC
AACACAGCCTCGGGCCGAGTTCGACTACTACGCGTCTGTTGAGCAGTCTGACATCGCCCCGACCCTTGCCGCGCT
GCTCGGATTCCCTGTGTCCAAAAATAACCTGGGCGCCTTCATACCCGACTTTCTGCCATTTTGGTCCAAAGACAG
CGATAGGCTTCAGATCCTTCTCCGCAACGCCAAGCAGATGCTCGGCATCGTCAAATCCGCATTTGGAGACCGTCT
TTTCGACACGCAGGGCACTCCCGACCCGTGCCGGATGGCTGCTACCAGCGTCAACGAGCTTGCCTGCGATTGGCG
TCGCATCAGTCGGGGGTCAGCATCCCCGGGCAATGTCGATTCGGTCTGGCTCTCGGATGCAGCGGCGTGGCTGCG
CAAGGCTCAGGATCTGATGAGCAGCATGGCCTCCAATTTCAGCACGGAGAAGCTGATGTACGGCCAGATAATGGG
CACTATAGCCGTGGGATTGGTTGTCCTCGCAATGCTGACGCAACAGACGCTCTCCGGCAACAGATATTGGCCTGT
TGTGGTCATCTCGCTGTTGTATGGCGTCATGAACTTTGCCAGCAGCTACGTGGAGGAGGAACAGCACTTTTGGTA
CTGGTCATGCTCGCTGTGGACGGCCTGGCTCGGCTCGCGCTCCATCCGCAGGTAAGACGACGTCTACCGTGCTCT
TACTGAGAGGCTCACTGGCGTACAGAACCGGGACACTGTGGCCCGCTGGCTACCATCTGCTGGCCCTTGTTTGCT
TGCGGCTGGCGAGAAGCTGGAACCAGACGGGCCAAAAGTTCGCCGGCGAGCCCGACATCGTCAAGCTGTTTCTCG
CCCCGAACCCGCAGTTCACCTGGGCACTCGTCAGCCTGGCTTATGCCATGGTCGCCTTTCGAATTGCAAAAAGCC
TGCCTGGTCTCCCGTCCGTCCTCAGGCTGTCCTTGACATCTGCCCTCATCTCTGCCGCCTTCAGCTTCAAGCTGG
CTTTTACAGCACAGGACGCCCCTGAGTTGGTGACGGGCCTCGCCGGAAAGGTCGACCAGGCATTGCAAGGCCCGT
CACTGATAGTCCGGGCGCGGTCCGTGTTCCTGCTTCTTGCGGTGGGAGCTGTCTTGGCCGTGATTAGAGGAGGCA
TGGGGCGTCATCTGGTGCAACCATCTGGTGGGTGTATAGGCGTCGACGGTCTGCTGTGGCATTGCTAACGAGATG
CCCAGCCCGTCTTCTCCACCATCTGTACACCCTGTTCGCCATGACGCAGTCTCGGACAACCAACATCCCTCTCCT
CGTGCTGGCCCAGACCATGTGCCATTGTCTCGAGATGGACGACCTGTCTCTGAGCGAAGTGACGACGTCGTGTCT
CTTGCTGCAACACGCCTTCTTCTTTGCCTTTGGTGGCTCCAACGCCATCTCATCGGTCGACTTGTCCAGCTCGTA
CAATGGCTTTGAGAACTTCAATGCCGTTGCCGTGGGCAGCCTCACTTTCGTCAGCAACTGGGCCGGTCCCATCTT
TTGGACGTCTGCCGCCAACCTTGTGCTTCTGCAGAAACAGGTGGGAAGTCGAGCCGATGTCTGCCGTCGCCATCT
GATGCTTCTCACTCTGTTCGTCAACGTCAGCGCGGTGTCCGTCATGGTGGCCTGCAACGCGCTGAGGACTCATTT
GTTCATCTGGACCGTCTTCTCGCCGAGGTATCTGTACGTGATGGCGTGGTCGATTGCCTATCATCTTGTGACGAA
TGTCGGACTCGGATCTCTTCTTTTCGTACTGGGCGCAAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail