Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|313
Gene name
LocationContig_1084:441..2116
Strand-
Gene length (bp)1675
Transcript length (bp)1635
Coding sequence length (bp)1635
Protein length (aa) 545

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01171 ATP_bind_3 PP-loop family 2.1E-37 8 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10441|TILS_SCHPO Probable tRNA(Ile)-lysidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.08c PE=3 SV=1 10 516 1.0E-24
sp|A5ERG8|TILS_BRASB tRNA(Ile)-lysidine synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tilS PE=3 SV=1 8 145 7.0E-16
sp|Q73FR9|TILS_WOLPM tRNA(Ile)-lysidine synthase OS=Wolbachia pipientis wMel GN=tilS PE=3 SV=1 8 240 7.0E-15
sp|C0R4S1|TILS_WOLWR tRNA(Ile)-lysidine synthase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=tilS PE=3 SV=1 8 240 3.0E-14
sp|Q5GTD2|TILS_WOLTR tRNA(Ile)-lysidine synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tilS PE=3 SV=1 8 238 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10441|TILS_SCHPO Probable tRNA(Ile)-lysidine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12B10.08c PE=3 SV=1 10 516 1.0E-24
sp|A5ERG8|TILS_BRASB tRNA(Ile)-lysidine synthase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tilS PE=3 SV=1 8 145 7.0E-16
sp|Q73FR9|TILS_WOLPM tRNA(Ile)-lysidine synthase OS=Wolbachia pipientis wMel GN=tilS PE=3 SV=1 8 240 7.0E-15
sp|C0R4S1|TILS_WOLWR tRNA(Ile)-lysidine synthase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=tilS PE=3 SV=1 8 240 3.0E-14
sp|Q5GTD2|TILS_WOLTR tRNA(Ile)-lysidine synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tilS PE=3 SV=1 8 238 6.0E-14
sp|B3CLY6|TILS_WOLPP tRNA(Ile)-lysidine synthase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=tilS PE=3 SV=1 8 240 1.0E-13
sp|Q9XBG6|TILS_BRADU tRNA(Ile)-lysidine synthase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=tilS PE=3 SV=1 6 244 2.0E-12
sp|B7GP48|TILS_BIFLS tRNA(Ile)-lysidine synthase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=tilS PE=3 SV=1 6 146 3.0E-12
sp|B3DR08|TILS_BIFLD tRNA(Ile)-lysidine synthase OS=Bifidobacterium longum (strain DJO10A) GN=tilS PE=3 SV=1 1 146 5.0E-12
sp|Q839B3|TILS_ENTFA tRNA(Ile)-lysidine synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tilS PE=3 SV=1 7 147 1.0E-11
sp|B8IP16|TILS_METNO tRNA(Ile)-lysidine synthase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=tilS PE=3 SV=1 7 240 2.0E-11
sp|Q8G3S4|TILS_BIFLO tRNA(Ile)-lysidine synthase OS=Bifidobacterium longum (strain NCC 2705) GN=tilS PE=3 SV=1 6 146 2.0E-11
sp|Q6NAQ6|TILS_RHOPA tRNA(Ile)-lysidine synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tilS PE=3 SV=1 6 145 4.0E-11
sp|Q5SI38|TILS_THET8 tRNA(Ile)-lysidine synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tilS PE=3 SV=1 8 136 8.0E-11
sp|Q72IF6|TILS_THET2 tRNA(Ile)-lysidine synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tilS PE=3 SV=1 8 136 8.0E-11
sp|Q92JY3|TILS_RHIME tRNA(Ile)-lysidine synthase OS=Rhizobium meliloti (strain 1021) GN=tilS PE=3 SV=1 8 138 1.0E-10
sp|Q181G3|TILS_PEPD6 tRNA(Ile)-lysidine synthase OS=Peptoclostridium difficile (strain 630) GN=tilS PE=3 SV=1 8 170 1.0E-10
sp|Q5FQB6|TILS_GLUOX tRNA(Ile)-lysidine synthase OS=Gluconobacter oxydans (strain 621H) GN=tilS PE=3 SV=1 8 145 2.0E-10
sp|Q2GC97|TILS_NOVAD tRNA(Ile)-lysidine synthase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tilS PE=3 SV=1 8 157 3.0E-10
sp|Q5P9R1|TILS_ANAMM tRNA(Ile)-lysidine synthase OS=Anaplasma marginale (strain St. Maries) GN=tilS PE=3 SV=2 10 147 8.0E-10
sp|Q8CQV3|TILS_STAES tRNA(Ile)-lysidine synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tilS PE=3 SV=1 4 269 9.0E-10
sp|Q5HRP5|TILS_STAEQ tRNA(Ile)-lysidine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tilS PE=3 SV=1 4 269 9.0E-10
sp|A5CFP2|TILS_ORITB tRNA(Ile)-lysidine synthase OS=Orientia tsutsugamushi (strain Boryong) GN=tilS PE=3 SV=1 3 186 1.0E-09
sp|B3CUJ5|TILS_ORITI tRNA(Ile)-lysidine synthase OS=Orientia tsutsugamushi (strain Ikeda) GN=tilS PE=3 SV=1 3 144 1.0E-09
sp|Q9PL79|TILS_CHLMU tRNA(Ile)-lysidine synthase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=tilS PE=3 SV=1 3 285 1.0E-09
sp|A1K3X8|TILS_AZOSB tRNA(Ile)-lysidine synthase OS=Azoarcus sp. (strain BH72) GN=tilS PE=3 SV=1 8 253 3.0E-09
sp|B0UGN1|TILS_METS4 tRNA(Ile)-lysidine synthase OS=Methylobacterium sp. (strain 4-46) GN=tilS PE=3 SV=1 10 145 4.0E-09
sp|Q6FYQ5|TILS_BARQU tRNA(Ile)-lysidine synthase OS=Bartonella quintana (strain Toulouse) GN=tilS PE=3 SV=1 8 297 4.0E-09
sp|Q5LNU7|TILS_RUEPO tRNA(Ile)-lysidine synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tilS PE=3 SV=1 8 240 5.0E-09
sp|Q6F880|TILS_ACIAD tRNA(Ile)-lysidine synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tilS PE=3 SV=1 10 155 7.0E-09
sp|Q9ZGE2|TILS_HELMO tRNA(Ile)-lysidine synthase OS=Heliobacillus mobilis GN=tilS PE=3 SV=1 5 146 9.0E-09
sp|Q81VX7|TILS_BACAN tRNA(Ile)-lysidine synthase OS=Bacillus anthracis GN=tilS PE=3 SV=1 4 145 1.0E-08
sp|Q6HPV4|TILS_BACHK tRNA(Ile)-lysidine synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tilS PE=3 SV=1 4 145 1.0E-08
sp|Q73N15|TILS_TREDE tRNA(Ile)-lysidine synthase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=tilS PE=3 SV=1 8 145 2.0E-08
sp|Q6AJ19|TILS_DESPS tRNA(Ile)-lysidine synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tilS PE=3 SV=1 8 149 2.0E-08
sp|Q88Z33|TILS_LACPL tRNA(Ile)-lysidine synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tilS PE=3 SV=1 7 148 2.0E-08
sp|Q63HD6|TILS_BACCZ tRNA(Ile)-lysidine synthase OS=Bacillus cereus (strain ZK / E33L) GN=tilS PE=3 SV=1 4 145 4.0E-08
sp|Q83MT2|TILS_TROWT tRNA(Ile)-lysidine synthase OS=Tropheryma whipplei (strain Twist) GN=tilS PE=3 SV=1 8 240 6.0E-08
sp|Q73FE5|TILS_BACC1 tRNA(Ile)-lysidine synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tilS PE=3 SV=1 4 145 7.0E-08
sp|Q5NLX8|TILS_ZYMMO tRNA(Ile)-lysidine synthase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tilS PE=3 SV=1 10 147 7.0E-08
sp|Q0C5V2|TILS_HYPNA tRNA(Ile)-lysidine synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=tilS PE=3 SV=1 8 290 9.0E-08
sp|Q8U9L7|TILS_AGRFC tRNA(Ile)-lysidine synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tilS PE=3 SV=1 8 148 2.0E-07
sp|Q83I94|TILS_TROW8 tRNA(Ile)-lysidine synthase OS=Tropheryma whipplei (strain TW08/27) GN=tilS PE=3 SV=1 8 240 2.0E-07
sp|Q98F87|TILS_RHILO tRNA(Ile)-lysidine synthase OS=Rhizobium loti (strain MAFF303099) GN=tilS PE=3 SV=1 11 145 2.0E-07
sp|Q8YAC7|TILS_LISMO Bifunctional protein TilS/HprT OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tilS/hprT PE=3 SV=1 10 145 3.0E-07
sp|Q822B9|TILS_CHLCV tRNA(Ile)-lysidine synthase OS=Chlamydophila caviae (strain GPIC) GN=tilS PE=3 SV=1 3 152 3.0E-07
sp|B2S2X0|TILS_TREPS tRNA(Ile)-lysidine synthase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=tilS PE=3 SV=1 4 145 4.0E-07
sp|Q63ST1|TILS_BURPS tRNA(Ile)-lysidine synthase OS=Burkholderia pseudomallei (strain K96243) GN=tilS PE=3 SV=1 91 250 4.0E-07
sp|B0B969|TILS_CHLT2 tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=tilS PE=3 SV=1 3 145 4.0E-07
sp|B0BAU8|TILS_CHLTB tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=tilS PE=3 SV=1 3 145 4.0E-07
sp|Q62J40|TILS_BURMA tRNA(Ile)-lysidine synthase OS=Burkholderia mallei (strain ATCC 23344) GN=tilS PE=3 SV=1 91 250 4.0E-07
sp|O83388|TILS_TREPA tRNA(Ile)-lysidine synthase OS=Treponema pallidum (strain Nichols) GN=tilS PE=3 SV=1 4 145 4.0E-07
sp|Q3KKJ9|TILS_CHLTA tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=tilS PE=3 SV=1 3 145 4.0E-07
sp|C1D1Q9|TILS_DEIDV tRNA(Ile)-lysidine synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=tilS PE=3 SV=1 50 182 4.0E-07
sp|O84847|TILS_CHLTR tRNA(Ile)-lysidine synthase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=tilS PE=3 SV=1 3 145 5.0E-07
sp|A3CJX7|TILS_STRSV tRNA(Ile)-lysidine synthase OS=Streptococcus sanguinis (strain SK36) GN=tilS PE=3 SV=1 8 145 8.0E-07
sp|B1I6Y3|TILS_STRPI tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=tilS PE=3 SV=1 9 154 9.0E-07
sp|B8ZJI9|TILS_STRPJ tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=tilS PE=3 SV=1 9 154 9.0E-07
sp|B2IQZ8|TILS_STRPS tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=tilS PE=3 SV=1 9 154 1.0E-06
sp|B5E578|TILS_STRP4 tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=tilS PE=3 SV=1 9 154 1.0E-06
sp|C1CNP4|TILS_STRZT tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=tilS PE=3 SV=1 9 154 1.0E-06
sp|C1CN76|TILS_STRZP tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain P1031) GN=tilS PE=3 SV=1 9 154 1.0E-06
sp|C1CH91|TILS_STRZJ tRNA(Ile)-lysidine synthase OS=Streptococcus pneumoniae (strain JJA) GN=tilS PE=3 SV=1 9 154 1.0E-06
sp|Q5L5B2|TILS_CHLAB tRNA(Ile)-lysidine synthase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tilS PE=3 SV=1 3 152 1.0E-06
sp|Q9Z6R2|TILS_CHLPN tRNA(Ile)-lysidine synthase OS=Chlamydia pneumoniae GN=tilS PE=3 SV=1 3 147 1.0E-06
sp|Q8KC15|TILS_CHLTE tRNA(Ile)-lysidine synthase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=tilS PE=3 SV=1 7 145 1.0E-06
sp|Q9RV23|TILS_DEIRA tRNA(Ile)-lysidine synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tilS PE=3 SV=2 8 146 2.0E-06
sp|Q82VP4|TILS_NITEU tRNA(Ile)-lysidine synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=tilS PE=3 SV=1 8 146 2.0E-06
sp|Q5L3T3|TILS_GEOKA tRNA(Ile)-lysidine synthase OS=Geobacillus kaustophilus (strain HTA426) GN=tilS PE=1 SV=1 7 146 3.0E-06
sp|Q724J4|TILS_LISMF Bifunctional protein TilS/HprT OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tilS/hprT PE=3 SV=1 10 145 4.0E-06
sp|Q9WZ48|TILS_THEMA tRNA(Ile)-lysidine synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tilS PE=3 SV=1 1 145 7.0E-06
sp|B1L8R5|TILS_THESQ tRNA(Ile)-lysidine synthase OS=Thermotoga sp. (strain RQ2) GN=tilS PE=3 SV=1 1 145 7.0E-06
sp|Q92F56|TILS_LISIN Bifunctional protein TilS/HprT OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tilS/hprT PE=3 SV=1 10 145 7.0E-06
sp|Q47KU2|TILS_THEFY tRNA(Ile)-lysidine synthase OS=Thermobifida fusca (strain YX) GN=tilS PE=3 SV=1 8 145 1.0E-05
sp|Q255L6|TILS_CHLFF tRNA(Ile)-lysidine synthase OS=Chlamydophila felis (strain Fe/C-56) GN=tilS PE=3 SV=1 3 145 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|313
MSDQRPSVTLAISGGVDSIAMAFLFSRLLKSDEGIRTADGTVRRAVGIVVDHQIRPGSALEALSVARELRRLGLG
AVVKRMRWCRAVDVSNVESLARTMRYRMLGVACRSLRARSLFFAHHRDDQYETVLMRLLAGHGYRGLGGIPDSND
IPECCDVHGVYKSGLKDEWTDSQTEQLSNFPRQDADDKNRQPPFSSLEPLECEDGGVSIHRPLLEFDKDRLVATC
EANGLRWFEDDTNSDPTLTMRNAVRYLVRTHRLPRALQKPAILALSERARLRRRTEESEAHRLLVREAVVKHFDP
NVGTLTVELPSLKPPRSNPFRRLFARERSRARRRHQRVVAAAAIRKLIDFVTPDTHLPPLTALAGTVDRLFPADG
RRRSAAFTMSGVLFRPEVGPERRWTLSRAPFPSSRPAPQQTFPGSEASRRGKCWTEIKLWDGRFWLRISSRVSAN
LIVKPLKPQHVQAFQRTLPPKQRARLQQLLRHHAAGKTRYSLPALYSEEATTRTTRLLALPSLGIDVPGLDRWVR
YGVRYRKTEGGLVGSGSDG*
Coding >Ophun1|313
ATGTCCGACCAAAGACCCTCGGTAACCCTCGCCATCAGCGGAGGCGTCGACTCCATCGCCATGGCCTTTCTCTTC
TCCCGCCTCCTTAAATCCGACGAGGGCATCAGAACAGCCGACGGCACCGTCAGACGCGCCGTGGGCATCGTTGTG
GACCATCAGATACGGCCGGGCAGCGCCCTCGAAGCTCTCTCTGTCGCGCGCGAGCTGCGGAGACTCGGATTGGGG
GCTGTGGTTAAAAGGATGAGATGGTGTCGAGCAGTGGACGTCTCTAATGTTGAGAGTCTGGCGCGGACTATGCGC
TATCGAATGCTTGGGGTTGCCTGTAGGAGTCTGCGGGCGAGGAGCCTCTTCTTTGCTCATCATCGTGATGATCAG
TATGAGACGGTGCTTATGCGGTTGCTTGCGGGCCATGGCTATCGGGGACTCGGGGGGATCCCGGACAGCAACGAC
ATCCCGGAGTGCTGCGATGTGCACGGCGTGTATAAGAGCGGTTTGAAGGATGAGTGGACGGATAGTCAGACTGAA
CAGCTGAGCAATTTCCCGCGACAAGACGCTGACGACAAGAACCGACAACCCCCCTTCTCAAGCCTCGAACCTCTC
GAATGCGAAGACGGAGGCGTCAGCATCCACCGCCCGTTGCTAGAGTTCGACAAAGACCGACTCGTGGCCACTTGC
GAAGCCAACGGGCTCCGCTGGTTCGAGGACGACACCAACTCGGACCCGACGCTGACGATGCGCAACGCTGTTCGA
TACCTGGTCAGAACGCATCGTTTGCCGCGAGCGCTGCAGAAGCCCGCCATCTTGGCCTTGTCGGAGCGGGCTAGA
CTAAGGAGGAGGACCGAGGAATCAGAGGCTCACAGACTGCTCGTGCGAGAGGCTGTAGTGAAGCACTTCGATCCC
AATGTCGGAACCCTCACCGTTGAGCTCCCCAGTCTGAAGCCACCCAGATCGAATCCCTTCAGACGGCTGTTCGCC
CGAGAGAGAAGCCGGGCGCGAAGGCGTCATCAGAGGGTGGTGGCTGCGGCGGCCATTCGCAAGCTCATCGACTTT
GTAACCCCCGACACCCACTTACCGCCCCTGACCGCCCTCGCCGGAACCGTGGACCGGCTATTCCCGGCTGACGGC
CGCCGTCGGTCCGCGGCCTTTACCATGTCCGGAGTCCTCTTTCGTCCGGAGGTGGGTCCGGAGCGGAGGTGGACC
CTTTCGCGGGCCCCCTTTCCGTCATCCCGGCCGGCCCCGCAGCAGACGTTTCCCGGGTCCGAAGCATCACGCCGT
GGGAAGTGCTGGACAGAAATCAAGCTCTGGGACGGACGCTTCTGGCTGCGAATAAGTTCGCGCGTTTCAGCGAAT
CTAATCGTCAAGCCCTTGAAGCCGCAGCACGTCCAAGCCTTCCAGCGAACGCTCCCCCCAAAACAACGAGCAAGA
CTCCAGCAGCTCCTCAGGCACCACGCCGCCGGAAAGACGCGATACTCTCTGCCAGCACTCTACAGCGAGGAAGCC
ACGACGCGGACCACCAGGCTCCTCGCGCTGCCGAGTCTCGGGATCGACGTCCCCGGGCTGGACCGGTGGGTTCGG
TATGGTGTGAGGTATAGGAAGACGGAGGGTGGGCTTGTGGGGTCTGGCTCGGATGGGTGA
Transcript >Ophun1|313
ATGTCCGACCAAAGACCCTCGGTAACCCTCGCCATCAGCGGAGGCGTCGACTCCATCGCCATGGCCTTTCTCTTC
TCCCGCCTCCTTAAATCCGACGAGGGCATCAGAACAGCCGACGGCACCGTCAGACGCGCCGTGGGCATCGTTGTG
GACCATCAGATACGGCCGGGCAGCGCCCTCGAAGCTCTCTCTGTCGCGCGCGAGCTGCGGAGACTCGGATTGGGG
GCTGTGGTTAAAAGGATGAGATGGTGTCGAGCAGTGGACGTCTCTAATGTTGAGAGTCTGGCGCGGACTATGCGC
TATCGAATGCTTGGGGTTGCCTGTAGGAGTCTGCGGGCGAGGAGCCTCTTCTTTGCTCATCATCGTGATGATCAG
TATGAGACGGTGCTTATGCGGTTGCTTGCGGGCCATGGCTATCGGGGACTCGGGGGGATCCCGGACAGCAACGAC
ATCCCGGAGTGCTGCGATGTGCACGGCGTGTATAAGAGCGGTTTGAAGGATGAGTGGACGGATAGTCAGACTGAA
CAGCTGAGCAATTTCCCGCGACAAGACGCTGACGACAAGAACCGACAACCCCCCTTCTCAAGCCTCGAACCTCTC
GAATGCGAAGACGGAGGCGTCAGCATCCACCGCCCGTTGCTAGAGTTCGACAAAGACCGACTCGTGGCCACTTGC
GAAGCCAACGGGCTCCGCTGGTTCGAGGACGACACCAACTCGGACCCGACGCTGACGATGCGCAACGCTGTTCGA
TACCTGGTCAGAACGCATCGTTTGCCGCGAGCGCTGCAGAAGCCCGCCATCTTGGCCTTGTCGGAGCGGGCTAGA
CTAAGGAGGAGGACCGAGGAATCAGAGGCTCACAGACTGCTCGTGCGAGAGGCTGTAGTGAAGCACTTCGATCCC
AATGTCGGAACCCTCACCGTTGAGCTCCCCAGTCTGAAGCCACCCAGATCGAATCCCTTCAGACGGCTGTTCGCC
CGAGAGAGAAGCCGGGCGCGAAGGCGTCATCAGAGGGTGGTGGCTGCGGCGGCCATTCGCAAGCTCATCGACTTT
GTAACCCCCGACACCCACTTACCGCCCCTGACCGCCCTCGCCGGAACCGTGGACCGGCTATTCCCGGCTGACGGC
CGCCGTCGGTCCGCGGCCTTTACCATGTCCGGAGTCCTCTTTCGTCCGGAGGTGGGTCCGGAGCGGAGGTGGACC
CTTTCGCGGGCCCCCTTTCCGTCATCCCGGCCGGCCCCGCAGCAGACGTTTCCCGGGTCCGAAGCATCACGCCGT
GGGAAGTGCTGGACAGAAATCAAGCTCTGGGACGGACGCTTCTGGCTGCGAATAAGTTCGCGCGTTTCAGCGAAT
CTAATCGTCAAGCCCTTGAAGCCGCAGCACGTCCAAGCCTTCCAGCGAACGCTCCCCCCAAAACAACGAGCAAGA
CTCCAGCAGCTCCTCAGGCACCACGCCGCCGGAAAGACGCGATACTCTCTGCCAGCACTCTACAGCGAGGAAGCC
ACGACGCGGACCACCAGGCTCCTCGCGCTGCCGAGTCTCGGGATCGACGTCCCCGGGCTGGACCGGTGGGTTCGG
TATGGTGTGAGGTATAGGAAGACGGAGGGTGGGCTTGTGGGGTCTGGCTCGGATGGGTGA
Gene >Ophun1|313
ATGTCCGACCAAAGACCCTCGGTAAGTCCCTACCTCTCATCACAACCAATGCTAAGACGTCTCAGCCCTCGCCAT
CAGCGGAGGCGTCGACTCCATCGCCATGGCCTTTCTCTTCTCCCGCCTCCTTAAATCCGACGAGGGCATCAGAAC
AGCCGACGGCACCGTCAGACGCGCCGTGGGCATCGTTGTGGACCATCAGATACGGCCGGGCAGCGCCCTCGAAGC
TCTCTCTGTCGCGCGCGAGCTGCGGAGACTCGGATTGGGGGCTGTGGTTAAAAGGATGAGATGGTGTCGAGCAGT
GGACGTCTCTAATGTTGAGAGTCTGGCGCGGACTATGCGCTATCGAATGCTTGGGGTTGCCTGTAGGAGTCTGCG
GGCGAGGAGCCTCTTCTTTGCTCATCATCGTGATGATCAGTATGAGACGGTGCTTATGCGGTTGCTTGCGGGCCA
TGGCTATCGGGGACTCGGGGGGATCCCGGACAGCAACGACATCCCGGAGTGCTGCGATGTGCACGGCGTGTATAA
GAGCGGTTTGAAGGATGAGTGGACGGATAGTCAGACTGAACAGCTGAGCAATTTCCCGCGACAAGACGCTGACGA
CAAGAACCGACAACCCCCCTTCTCAAGCCTCGAACCTCTCGAATGCGAAGACGGAGGCGTCAGCATCCACCGCCC
GTTGCTAGAGTTCGACAAAGACCGACTCGTGGCCACTTGCGAAGCCAACGGGCTCCGCTGGTTCGAGGACGACAC
CAACTCGGACCCGACGCTGACGATGCGCAACGCTGTTCGATACCTGGTCAGAACGCATCGTTTGCCGCGAGCGCT
GCAGAAGCCCGCCATCTTGGCCTTGTCGGAGCGGGCTAGACTAAGGAGGAGGACCGAGGAATCAGAGGCTCACAG
ACTGCTCGTGCGAGAGGCTGTAGTGAAGCACTTCGATCCCAATGTCGGAACCCTCACCGTTGAGCTCCCCAGTCT
GAAGCCACCCAGATCGAATCCCTTCAGACGGCTGTTCGCCCGAGAGAGAAGCCGGGCGCGAAGGCGTCATCAGAG
GGTGGTGGCTGCGGCGGCCATTCGCAAGCTCATCGACTTTGTAACCCCCGACACCCACTTACCGCCCCTGACCGC
CCTCGCCGGAACCGTGGACCGGCTATTCCCGGCTGACGGCCGCCGTCGGTCCGCGGCCTTTACCATGTCCGGAGT
CCTCTTTCGTCCGGAGGTGGGTCCGGAGCGGAGGTGGACCCTTTCGCGGGCCCCCTTTCCGTCATCCCGGCCGGC
CCCGCAGCAGACGTTTCCCGGGTCCGAAGCATCACGCCGTGGGAAGTGCTGGACAGAAATCAAGCTCTGGGACGG
ACGCTTCTGGCTGCGAATAAGTTCGCGCGTTTCAGCGAATCTAATCGTCAAGCCCTTGAAGCCGCAGCACGTCCA
AGCCTTCCAGCGAACGCTCCCCCCAAAACAACGAGCAAGACTCCAGCAGCTCCTCAGGCACCACGCCGCCGGAAA
GACGCGATACTCTCTGCCAGCACTCTACAGCGAGGAAGCCACGACGCGGACCACCAGGCTCCTCGCGCTGCCGAG
TCTCGGGATCGACGTCCCCGGGCTGGACCGGTGGGTTCGGTATGGTGTGAGGTATAGGAAGACGGAGGGTGGGCT
TGTGGGGTCTGGCTCGGATGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail