Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3126
Gene name
LocationContig_279:18047..22467
Strand+
Gene length (bp)4420
Transcript length (bp)3723
Coding sequence length (bp)3723
Protein length (aa) 1241

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 2.3E-03 934 969
PF08238 Sel1 Sel1 repeat 6.4E-07 970 1009
PF08238 Sel1 Sel1 repeat 6.4E-07 1011 1044
PF08238 Sel1 Sel1 repeat 1.2E+00 1050 1088
PF08238 Sel1 Sel1 repeat 1.1E-06 1091 1123
PF08238 Sel1 Sel1 repeat 4.0E+00 1130 1159
PF08238 Sel1 Sel1 repeat 1.8E-03 1164 1197
PF13640 2OG-FeII_Oxy_3 2OG-Fe(II) oxygenase superfamily 3.8E-08 133 249

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 851 1240 8.0E-66
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 893 1206 6.0E-49
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 907 1209 5.0E-41
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 784 1232 5.0E-36
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 934 1159 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 851 1240 8.0E-66
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 893 1206 6.0E-49
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 907 1209 5.0E-41
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 784 1232 5.0E-36
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 934 1159 3.0E-28
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 913 1088 1.0E-19
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 913 1088 1.0E-19
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 934 1218 6.0E-17
sp|P77296|YBET_ECOLI Uncharacterized protein YbeT OS=Escherichia coli (strain K12) GN=ybeT PE=2 SV=1 1087 1209 2.0E-10
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 948 1139 6.0E-10
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 987 1191 1.0E-08
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 1005 1197 2.0E-08
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 986 1238 3.0E-08
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 1043 1214 5.0E-08
sp|Q9ZG88|PODJ_CAUCR Localization factor PodJL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=podJ PE=1 SV=2 1054 1191 9.0E-08
sp|B8GXA0|PODJ_CAUCN Localization factor PodJL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=podJ PE=2 SV=1 1054 1191 9.0E-08
sp|O59732|CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr1 PE=1 SV=1 1027 1184 1.0E-07
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 919 1140 1.0E-07
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 998 1139 3.0E-07
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 998 1139 3.0E-07
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 881 1191 3.0E-07
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 998 1139 3.0E-07
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 998 1139 3.0E-07
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 934 1122 3.0E-07
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 934 1122 2.0E-06
sp|Q9ZMJ9|HCPE_HELPJ Putative beta-lactamase HcpE OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=hcpE PE=3 SV=1 979 1194 4.0E-06
sp|O25021|HCPE_HELPY Putative beta-lactamase HcpE OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=hcpE PE=3 SV=1 979 1143 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4381
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5290
Ophiocordyceps australis map64 (Brazil) OphauB2|5055
Ophiocordyceps camponoti-floridani Ophcf2|06152
Ophiocordyceps camponoti-rufipedis Ophun1|3126 (this protein)
Ophiocordyceps kimflemingae Ophio5|4353
Ophiocordyceps subramaniannii Hirsu2|9070

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3126
MPKAKTSSKRPPATSEPAQQPPSWPRFKPALPVADLAPQLHPATSKIALIPSFFPRSLCRDFVAFLRTLPLQTTP
GRPKRGEATRVNDRFQVDDGHFARRLWEETGLKEALTLSDDVRDLWGGEPVGLNANIRVYRYTTGQFFDCHYDDD
NDVDVSTDPPTPARTTWTLLLYLTSSTEGCVGGETVFYTRDRKSPAEAIVVPPETGLLLLHKHGADCLLVGVGSV
LCSVWLTRLQHEGREVTAGEKWVLRTDICVRRIDRPSVYFGLAESLADLAGSHPMSRPRDSGRSAGRRRSKLQVP
GPAGWILQRLAPRTRALSQVGLVRATDSVCSARMYKYRGCGPTSTLLRQFSMWDPSTGDFCPPATCPDLSQRAPL
NHGPLPRLPRFAPLQTPTLTNFPRLSSNLSCAIVPQQTINRHDDSILLDYAPLTRTSILTTPSPGHEDMSYHGVG
GPQRPYPPPQPAPPRGYGERQMPQQQHGGPPRGQYDDGYGHYGPQVQRHRPGPEPVPHRWRSEPGRGAPGPQTAV
PRGPSSDHGSVRRPQMPHGPDSYPGPPRDYHGHGGYDEQGPDRSQFVPPGRSMTMPSQDAVRQGAMQQPPPPPHR
ADTMPYHDPAGRGGGVPPRPSTATGSRPPPRRMLPPQPQGQPQEWHGRGYRQETSEEGFDSYFAQPGPAEAEGRG
PPPDPRRGAPHQMPRLHHAKSEANFREPQMAVFEMPAEVPMMPAVPPIQAYQPEYAGGYGRGGGGGGGGFEPMGS
RGPPPPGHANGQHRFHGYDPRPGTAPPQQQQQMSSPDALPSHPTPVRPGHMANSMVSVNDRPPPVRNYGGVPQNG
PPQQQQQQQLQQAPPQQGRVAVRAGLQVPEPAMTGQLVTPSELEQLRMAIKHNANDHDSALMLARKLVEAADVLI
ANIPDAKQRARTRERYLMDAHKILKKLANAQNQEAMFIMADGLGRGLFGHEPDNKEAFALYHSAAKLGHAAAAYR
TAVCCEIGQEEGGGTRKDPLKAMQWYRRAATLGDPPAMYKVGMILLKGLLGQNKNPREAVGWLRRAAERANEENP
HALHELGLLYESAQSNDVIIRDERYALSLFQDAADLGYKFSQFRLGCAFEYGLMGCPIDPRQSIFWYSKAAAQAE
HQSELALSGWYLTGSDGVLGQSDTEAYLWARKAAVAGLAKAEYAMGYFTEVGIGVPANLEDAKRWYWRAAAQEFP
KARERLEDLKRAGKHGRPRERERISRSRIERQQEGECSVM*
Coding >Ophun1|3126
ATGCCCAAGGCTAAGACCTCATCGAAGCGCCCACCTGCGACGTCCGAACCAGCACAACAGCCCCCGTCGTGGCCC
CGGTTCAAGCCTGCGCTGCCGGTAGCCGATCTCGCGCCGCAGCTGCACCCCGCGACGTCCAAAATCGCCCTCATC
CCGAGCTTCTTCCCGCGTTCGCTGTGCCGCGACTTCGTGGCTTTTCTAAGAACGCTGCCGCTGCAGACGACGCCG
GGAAGGCCGAAGCGCGGTGAGGCGACGCGCGTGAATGATCGGTTTCAGGTCGATGATGGGCATTTTGCGCGTCGG
CTTTGGGAGGAGACGGGCTTGAAGGAGGCTCTGACTCTGAGTGATGACGTTAGGGATCTGTGGGGTGGCGAGCCT
GTTGGGTTGAATGCCAACATTCGGGTGTATCGCTACACCACGGGGCAATTCTTTGATTGTCATTACGATGACGAC
AATGACGTGGACGTCTCAACGGATCCGCCGACGCCCGCTCGCACTACCTGGACGCTGCTCCTCTATCTGACTTCT
TCGACAGAGGGTTGCGTCGGCGGCGAGACGGTCTTCTACACGCGCGACCGCAAGTCTCCGGCCGAGGCGATTGTT
GTGCCGCCGGAGACGGGCCTGCTGCTGCTGCACAAGCACGGCGCAGACTGTCTACTGGTGGGTGTCGGCAGCGTT
CTCTGCAGTGTCTGGCTGACGAGGTTGCAGCACGAGGGCCGTGAGGTGACGGCAGGGGAGAAATGGGTCCTGCGA
ACGGATATCTGCGTCAGGAGGATCGACCGGCCCAGTGTCTATTTCGGACTGGCTGAGTCGCTTGCTGACCTCGCA
GGGTCTCATCCCATGTCTCGTCCGCGTGACTCCGGACGGAGCGCCGGACGAAGACGCAGTAAGCTCCAGGTCCCG
GGCCCGGCTGGATGGATTCTCCAGCGCCTGGCCCCGCGCACGCGTGCCCTGAGCCAGGTCGGCCTTGTGCGGGCG
ACAGATTCAGTCTGCAGCGCGCGCATGTACAAGTACCGCGGATGTGGCCCCACCTCCACCCTGTTGCGCCAGTTT
TCCATGTGGGATCCAAGTACCGGAGACTTCTGCCCTCCGGCCACCTGCCCTGACCTCAGCCAGCGGGCTCCCCTG
AATCATGGCCCTCTTCCACGTCTCCCTCGATTCGCACCTCTTCAGACGCCGACTCTCACCAACTTCCCTCGCCTC
TCCTCGAACCTCAGCTGTGCCATCGTCCCACAGCAGACCATTAATAGGCACGACGACTCGATTCTCTTGGACTAT
GCGCCCTTGACACGCACGTCCATCCTGACGACTCCTTCGCCCGGGCACGAAGATATGAGCTATCACGGCGTCGGG
GGGCCTCAGCGCCCGTATCCTCCGCCGCAGCCGGCTCCGCCTCGTGGCTATGGCGAACGGCAAATGCCTCAGCAG
CAGCATGGCGGACCTCCGCGCGGGCAGTACGACGACGGCTATGGTCATTACGGTCCGCAGGTTCAGCGGCATCGT
CCTGGTCCCGAACCTGTCCCGCATCGTTGGCGGTCGGAGCCGGGAAGAGGCGCTCCCGGACCGCAGACGGCTGTT
CCGCGTGGTCCCAGCTCGGATCATGGATCTGTTCGTCGCCCGCAAATGCCTCACGGACCGGATAGTTATCCCGGG
CCGCCGCGGGATTATCATGGCCACGGCGGTTACGACGAGCAGGGCCCCGATAGGTCTCAGTTCGTTCCTCCTGGT
CGAAGCATGACGATGCCCTCGCAGGATGCTGTGAGGCAGGGCGCAATGCAGCAACCGCCTCCGCCGCCGCATAGA
GCCGACACGATGCCGTATCACGACCCTGCTGGTCGGGGTGGTGGTGTGCCCCCGAGGCCGTCGACGGCGACGGGG
AGTCGACCTCCGCCGCGGAGAATGCTTCCTCCTCAGCCTCAAGGCCAGCCGCAAGAATGGCATGGCCGCGGCTAT
CGTCAGGAGACGTCGGAAGAAGGCTTCGACTCGTACTTCGCCCAGCCCGGTCCTGCGGAAGCCGAGGGACGAGGA
CCGCCACCTGACCCACGAAGAGGAGCTCCACACCAGATGCCGAGATTGCACCACGCCAAGTCCGAGGCCAACTTT
CGCGAGCCTCAGATGGCTGTTTTCGAGATGCCTGCCGAGGTGCCCATGATGCCTGCCGTGCCGCCCATCCAGGCC
TATCAGCCCGAATATGCCGGTGGCTACGGTCGGGGAGGAGGAGGCGGCGGCGGTGGCTTCGAGCCCATGGGATCG
CGCGGTCCGCCGCCGCCAGGGCATGCAAACGGACAGCACCGGTTTCATGGTTATGATCCGAGACCTGGCACGGCG
CCGCCGCAACAGCAGCAGCAGATGTCGTCGCCGGACGCGCTGCCGTCTCATCCGACGCCTGTGCGGCCGGGACAC
ATGGCCAACTCAATGGTCAGCGTCAACGACCGGCCGCCGCCGGTGCGCAACTACGGCGGTGTGCCGCAGAACGGA
CCGCCGCAGCAGCAGCAGCAGCAGCAGCTCCAACAAGCACCACCGCAGCAGGGCCGAGTGGCGGTTCGAGCCGGC
CTTCAGGTGCCGGAGCCGGCGATGACGGGACAGCTCGTCACACCGAGCGAGCTGGAGCAGCTGCGGATGGCCATC
AAGCACAACGCCAACGACCATGACTCGGCGCTTATGCTGGCCAGGAAGCTAGTCGAGGCGGCCGACGTGCTGATA
GCCAACATACCGGACGCAAAGCAGCGGGCCCGGACCCGGGAGCGTTATCTCATGGACGCGCACAAGATCCTCAAG
AAGCTGGCCAACGCGCAGAACCAGGAGGCCATGTTCATCATGGCCGACGGCCTCGGCAGGGGACTCTTTGGCCAC
GAGCCGGACAACAAGGAGGCCTTTGCGCTTTACCACTCGGCCGCCAAGCTGGGACACGCGGCGGCGGCCTACCGG
ACGGCCGTCTGCTGCGAGATCGGACAGGAAGAGGGCGGCGGAACGCGCAAGGATCCCCTCAAGGCCATGCAGTGG
TATCGAAGAGCGGCGACGCTGGGCGATCCGCCGGCCATGTACAAGGTGGGCATGATCCTGCTCAAGGGTCTGCTG
GGCCAGAACAAGAACCCGCGAGAGGCCGTCGGCTGGCTGAGGAGGGCTGCCGAAAGAGCCAACGAGGAGAACCCG
CACGCGCTGCACGAGCTGGGGCTTCTATACGAGTCGGCGCAGTCCAACGACGTCATCATCCGCGACGAGCGCTAC
GCCCTCAGCCTCTTCCAGGACGCGGCCGATCTGGGCTACAAGTTCTCGCAGTTCCGGCTCGGCTGCGCGTTCGAG
TACGGCCTCATGGGCTGTCCGATCGACCCGCGTCAGTCCATCTTCTGGTACTCCAAGGCGGCGGCCCAGGCCGAG
CACCAGTCGGAGCTGGCCCTGAGCGGCTGGTACCTGACGGGCAGCGACGGCGTGCTGGGCCAGAGCGACACCGAG
GCTTACCTCTGGGCGCGCAAGGCTGCCGTTGCAGGGCTGGCCAAGGCTGAGTATGCCATGGGCTACTTTACCGAG
GTCGGCATCGGGGTGCCGGCGAACTTGGAGGATGCGAAGCGGTGGTACTGGCGGGCAGCTGCCCAGGAGTTTCCC
AAGGCACGCGAGAGGCTCGAGGATCTCAAGCGCGCGGGCAAACACGGGCGTCCACGCGAGCGAGAGCGCATTTCC
AGGAGTCGGATCGAGCGTCAGCAGGAGGGCGAGTGCAGCGTAATGTGA
Transcript >Ophun1|3126
ATGCCCAAGGCTAAGACCTCATCGAAGCGCCCACCTGCGACGTCCGAACCAGCACAACAGCCCCCGTCGTGGCCC
CGGTTCAAGCCTGCGCTGCCGGTAGCCGATCTCGCGCCGCAGCTGCACCCCGCGACGTCCAAAATCGCCCTCATC
CCGAGCTTCTTCCCGCGTTCGCTGTGCCGCGACTTCGTGGCTTTTCTAAGAACGCTGCCGCTGCAGACGACGCCG
GGAAGGCCGAAGCGCGGTGAGGCGACGCGCGTGAATGATCGGTTTCAGGTCGATGATGGGCATTTTGCGCGTCGG
CTTTGGGAGGAGACGGGCTTGAAGGAGGCTCTGACTCTGAGTGATGACGTTAGGGATCTGTGGGGTGGCGAGCCT
GTTGGGTTGAATGCCAACATTCGGGTGTATCGCTACACCACGGGGCAATTCTTTGATTGTCATTACGATGACGAC
AATGACGTGGACGTCTCAACGGATCCGCCGACGCCCGCTCGCACTACCTGGACGCTGCTCCTCTATCTGACTTCT
TCGACAGAGGGTTGCGTCGGCGGCGAGACGGTCTTCTACACGCGCGACCGCAAGTCTCCGGCCGAGGCGATTGTT
GTGCCGCCGGAGACGGGCCTGCTGCTGCTGCACAAGCACGGCGCAGACTGTCTACTGGTGGGTGTCGGCAGCGTT
CTCTGCAGTGTCTGGCTGACGAGGTTGCAGCACGAGGGCCGTGAGGTGACGGCAGGGGAGAAATGGGTCCTGCGA
ACGGATATCTGCGTCAGGAGGATCGACCGGCCCAGTGTCTATTTCGGACTGGCTGAGTCGCTTGCTGACCTCGCA
GGGTCTCATCCCATGTCTCGTCCGCGTGACTCCGGACGGAGCGCCGGACGAAGACGCAGTAAGCTCCAGGTCCCG
GGCCCGGCTGGATGGATTCTCCAGCGCCTGGCCCCGCGCACGCGTGCCCTGAGCCAGGTCGGCCTTGTGCGGGCG
ACAGATTCAGTCTGCAGCGCGCGCATGTACAAGTACCGCGGATGTGGCCCCACCTCCACCCTGTTGCGCCAGTTT
TCCATGTGGGATCCAAGTACCGGAGACTTCTGCCCTCCGGCCACCTGCCCTGACCTCAGCCAGCGGGCTCCCCTG
AATCATGGCCCTCTTCCACGTCTCCCTCGATTCGCACCTCTTCAGACGCCGACTCTCACCAACTTCCCTCGCCTC
TCCTCGAACCTCAGCTGTGCCATCGTCCCACAGCAGACCATTAATAGGCACGACGACTCGATTCTCTTGGACTAT
GCGCCCTTGACACGCACGTCCATCCTGACGACTCCTTCGCCCGGGCACGAAGATATGAGCTATCACGGCGTCGGG
GGGCCTCAGCGCCCGTATCCTCCGCCGCAGCCGGCTCCGCCTCGTGGCTATGGCGAACGGCAAATGCCTCAGCAG
CAGCATGGCGGACCTCCGCGCGGGCAGTACGACGACGGCTATGGTCATTACGGTCCGCAGGTTCAGCGGCATCGT
CCTGGTCCCGAACCTGTCCCGCATCGTTGGCGGTCGGAGCCGGGAAGAGGCGCTCCCGGACCGCAGACGGCTGTT
CCGCGTGGTCCCAGCTCGGATCATGGATCTGTTCGTCGCCCGCAAATGCCTCACGGACCGGATAGTTATCCCGGG
CCGCCGCGGGATTATCATGGCCACGGCGGTTACGACGAGCAGGGCCCCGATAGGTCTCAGTTCGTTCCTCCTGGT
CGAAGCATGACGATGCCCTCGCAGGATGCTGTGAGGCAGGGCGCAATGCAGCAACCGCCTCCGCCGCCGCATAGA
GCCGACACGATGCCGTATCACGACCCTGCTGGTCGGGGTGGTGGTGTGCCCCCGAGGCCGTCGACGGCGACGGGG
AGTCGACCTCCGCCGCGGAGAATGCTTCCTCCTCAGCCTCAAGGCCAGCCGCAAGAATGGCATGGCCGCGGCTAT
CGTCAGGAGACGTCGGAAGAAGGCTTCGACTCGTACTTCGCCCAGCCCGGTCCTGCGGAAGCCGAGGGACGAGGA
CCGCCACCTGACCCACGAAGAGGAGCTCCACACCAGATGCCGAGATTGCACCACGCCAAGTCCGAGGCCAACTTT
CGCGAGCCTCAGATGGCTGTTTTCGAGATGCCTGCCGAGGTGCCCATGATGCCTGCCGTGCCGCCCATCCAGGCC
TATCAGCCCGAATATGCCGGTGGCTACGGTCGGGGAGGAGGAGGCGGCGGCGGTGGCTTCGAGCCCATGGGATCG
CGCGGTCCGCCGCCGCCAGGGCATGCAAACGGACAGCACCGGTTTCATGGTTATGATCCGAGACCTGGCACGGCG
CCGCCGCAACAGCAGCAGCAGATGTCGTCGCCGGACGCGCTGCCGTCTCATCCGACGCCTGTGCGGCCGGGACAC
ATGGCCAACTCAATGGTCAGCGTCAACGACCGGCCGCCGCCGGTGCGCAACTACGGCGGTGTGCCGCAGAACGGA
CCGCCGCAGCAGCAGCAGCAGCAGCAGCTCCAACAAGCACCACCGCAGCAGGGCCGAGTGGCGGTTCGAGCCGGC
CTTCAGGTGCCGGAGCCGGCGATGACGGGACAGCTCGTCACACCGAGCGAGCTGGAGCAGCTGCGGATGGCCATC
AAGCACAACGCCAACGACCATGACTCGGCGCTTATGCTGGCCAGGAAGCTAGTCGAGGCGGCCGACGTGCTGATA
GCCAACATACCGGACGCAAAGCAGCGGGCCCGGACCCGGGAGCGTTATCTCATGGACGCGCACAAGATCCTCAAG
AAGCTGGCCAACGCGCAGAACCAGGAGGCCATGTTCATCATGGCCGACGGCCTCGGCAGGGGACTCTTTGGCCAC
GAGCCGGACAACAAGGAGGCCTTTGCGCTTTACCACTCGGCCGCCAAGCTGGGACACGCGGCGGCGGCCTACCGG
ACGGCCGTCTGCTGCGAGATCGGACAGGAAGAGGGCGGCGGAACGCGCAAGGATCCCCTCAAGGCCATGCAGTGG
TATCGAAGAGCGGCGACGCTGGGCGATCCGCCGGCCATGTACAAGGTGGGCATGATCCTGCTCAAGGGTCTGCTG
GGCCAGAACAAGAACCCGCGAGAGGCCGTCGGCTGGCTGAGGAGGGCTGCCGAAAGAGCCAACGAGGAGAACCCG
CACGCGCTGCACGAGCTGGGGCTTCTATACGAGTCGGCGCAGTCCAACGACGTCATCATCCGCGACGAGCGCTAC
GCCCTCAGCCTCTTCCAGGACGCGGCCGATCTGGGCTACAAGTTCTCGCAGTTCCGGCTCGGCTGCGCGTTCGAG
TACGGCCTCATGGGCTGTCCGATCGACCCGCGTCAGTCCATCTTCTGGTACTCCAAGGCGGCGGCCCAGGCCGAG
CACCAGTCGGAGCTGGCCCTGAGCGGCTGGTACCTGACGGGCAGCGACGGCGTGCTGGGCCAGAGCGACACCGAG
GCTTACCTCTGGGCGCGCAAGGCTGCCGTTGCAGGGCTGGCCAAGGCTGAGTATGCCATGGGCTACTTTACCGAG
GTCGGCATCGGGGTGCCGGCGAACTTGGAGGATGCGAAGCGGTGGTACTGGCGGGCAGCTGCCCAGGAGTTTCCC
AAGGCACGCGAGAGGCTCGAGGATCTCAAGCGCGCGGGCAAACACGGGCGTCCACGCGAGCGAGAGCGCATTTCC
AGGAGTCGGATCGAGCGTCAGCAGGAGGGCGAGTGCAGCGTAATGTGA
Gene >Ophun1|3126
ATGCCCAAGGCTAAGACCTCATCGAAGCGCCCACCTGCGACGTCCGAACCAGCACAACAGCCCCCGTCGTGGCCC
CGGTTCAAGCCTGCGCTGCCGGTAGCCGATCTCGCGCCGCAGCTGCACCCCGCGACGTCCAAAATCGCCCTCATC
CCGAGCTTCTTCCCGCGTTCGCTGTGCCGCGACTTCGTGGCTTTTCTAAGAACGCTGCCGCTGCAGACGACGCCG
GGAAGGCCGAAGCGCGGTGAGGCGACGCGCGTGAATGATCGGTTTCAGGTCGATGATGGGCATTTTGCGCGTCGG
CTTTGGGAGGAGACGGGCTTGAAGGAGGCTCTGACTCTGAGTGATGACGTTAGGGATCTGTGGTGCGTTTGTGGG
GAGTGTGTTGCGATTGGGAATGCTGATTTTCATAGGGGTGGCGAGCCTGTTGGGTTGAATGCCAACATTCGGGTG
TATCGCTACACCACGGGGCAATTCTTTGATTGTCATTGTGCGTCTCTGTCTTGCGCTAGATACAATCGCCGCGGC
TGACATGAAGACATCCTACGGAGGAAGACGATGACGACAATGACGTGGACGTCTCAACGGATCCGCCGACGCCCG
CTCGCACTACCTGGACGCTGCTCCTCTATCTGACTTCTTCGACAGAGGGTTGCGTCGGCGGCGAGACGGTCTTCT
ACACGCGCGACCGCAAGTCTCCGGCCGAGGCGATTGTTGTGCCGCCGGAGACGGGCCTGCTGCTGCTGCACAAGC
ACGGCGCAGACTGTCTACTGGTGGGTGTCGGCAGCGTTCTCTGCAGTGTCTGGCTGACGAGGTTGCAGCACGAGG
GCCGTGAGGTGACGGCAGGGGAGAAATGGGTCCTGCGAACGGATATCTGCGTCAGGAGGTGAATGACGGCGACGA
TGAAGGGCTCGACGTGTGGTCCTCTGTCGTGTTACAGGATCGACCGGCCCAGTGTCTATTTCGGACTGGCTGAGT
CGCTTGCTGACCTCGCAGGGTCTCATCCCATGTCTCGTCCGCGTGACTCCGGACGGAGCGCCGGACGAAGACGCA
GTGTAGCATGGCGTGCAGCTGCGACTGCAAGGGACCGGGATTCGCAATTCGCTGGCTGCCGTCAGCGTTGGGAGG
TCGTCCACTGAGAGAGGTCGGGTTTATGCGGATAACAGGCGCCAGGATCGAGGATGGAGTGGAATGCTGGCGGTG
GTCGCGGGCCAACGGGCAGCCTGGGACCGGGCGCTTGGAGGAGTTGTGAGGATGGAGGAAGATAGTAGGTAGAGG
ACGGATTGTTGTAGAGGAGCGTGAAGCGCGGGAAATGGATGGATGGGATGGATTGGTCTTCCAGGTCCTCCATCC
CATCCCTCCACCTAGAAGCTCCAGGTCCCGGGCCCGGCTGGATGGATTCTCCAGCGCCTGGCCCCGCGCACGCGT
GCCCTGAGCCAGGTCGGCCTTGTGCGGGCGACAGATTCAGTCTGCAGCGCGCGCATGTACAAGTACCGCGGATGT
GGCCCCACCTCCACCCTGTTGCGCCAGTTTTCCATGTGGGATCCAAGTACCGGAGACTTCTGCCCTCCGGCCACC
TGCCCTGACCTCAGCCAGCGGGCTCCCCTGAATCATGGCCCTCTTCCACGTCTCCCTCGATTCGCACCTCTTCAG
ACGCCGACTCTCACCAACTTCCCTCGCCTCTCCTCGAACCTCAGCTGTGCCATCGTCCCACAGCAGACCATTAAT
AGGCGTGAGCCCAGCGCCCGAAACATCCTCCCTGTCCGCCCGCTGAGGCCCACGACAATTACCACGACGACGAAG
ACGACGACTCGATTCTCTTGGACTATGCGCCCTTGACACGCACGTCCATCCTGACGACTCCTTCGCCCGGGCACG
AAGATATGAGCTATCACGGCGTCGGGGGGCCTCAGCGCCCGTATCCTCCGCCGCAGCCGGCTCCGCCTCGTGGCT
ATGGCGAACGGCAAATGCCTCAGCAGCAGCATGGCGGACCTCCGCGCGGGCAGTACGACGACGGCTATGGTCATT
ACGGTCCGCAGGTTCAGCGGCATCGTCCTGGTCCCGAACCTGTCCCGCATCGTTGGCGGTCGGAGCCGGGAAGAG
GCGCTCCCGGACCGCAGACGGCTGTTCCGCGTGGTCCCAGCTCGGATCATGGATGTGAGCTCGTCCCTCCCCCCC
TTGGTGCTGTTGGCCTGTTGGGTTCTGTTTTCCCTTACTCACGGCTCCCTTCTTTCTTGAAGCTGTTCGTCGCCC
GCAAATGCCTCACGGACCGGATAGTTATCCCGGGCCGCCGCGGGATTATCATGGCCACGGCGGTTACGACGAGCA
GGGCCCCGATAGGTCTCAGTTCGTTCCTCCTGGTCGAAGCATGACGATGCCCTCGCAGGATGCTGTGAGGCAGGG
CGCAATGCAGCAACCGCCTCCGCCGCCGCATAGAGCCGACACGATGCCGTATCACGACCCTGCTGGTCGGGGTGG
TGGTGTGCCCCCGAGGCCGTCGACGGCGACGGGGAGTCGACCTCCGCCGCGGAGAATGCTTCCTCCTCAGCCTCA
AGGCCAGCCGCAAGAATGGCATGGCCGCGGCTATCGTCAGGAGACGTCGGAAGAAGGCTTCGACTCGTACTTCGC
CCAGCCCGGTCCTGCGGAAGCCGAGGGACGAGGACCGCCACCTGACCCACGAAGAGGAGCTCCACACCAGATGCC
GAGATTGCACCACGCCAAGTCCGAGGCCAACTTTCGCGAGCCTCAGATGGCTGTTTTCGAGATGCCTGCCGAGGT
GCCCATGATGCCTGCCGTGCCGCCCATCCAGGCCTATCAGCCCGAATATGCCGGTGGCTACGGTCGGGGAGGAGG
AGGCGGCGGCGGTGGCTTCGAGCCCATGGGATCGCGCGGTCCGCCGCCGCCAGGGCATGCAAACGGACAGCACCG
GTTTCATGGTTATGATCCGAGACCTGGCACGGCGCCGCCGCAACAGCAGCAGCAGATGTCGTCGCCGGACGCGCT
GCCGTCTCATCCGACGCCTGTGCGGCCGGGACACATGGCCAACTCAATGGTCAGCGTCAACGACCGGCCGCCGCC
GGTGCGCAACTACGGCGGTGTGCCGCAGAACGGACCGCCGCAGCAGCAGCAGCAGCAGCAGCTCCAACAAGCACC
ACCGCAGCAGGGCCGAGTGGCGGTTCGAGCCGGCCTTCAGGTGCCGGAGCCGGCGATGACGGGACAGCTCGTCAC
ACCGAGCGAGCTGGAGCAGCTGCGGATGGCCATCAAGCACAACGCCAACGACCATGACTCGGCGCTTATGCTGGC
CAGGAAGCTAGTCGAGGCGGCCGACGTGCTGATAGCCAACATACCGGACGCAAAGCAGCGGGCCCGGACCCGGGA
GCGTTATCTCATGGACGCGCACAAGATCCTCAAGAAGCTGGCCAACGCGCAGAACCAGGAGGCCATGTTCATCAT
GGCCGACGGCCTCGGCAGGGGACTCTTTGGCCACGAGCCGGACAACAAGGAGGCCTTTGCGCTTTACCACTCGGC
CGCCAAGCTGGGACACGCGGCGGCGGCCTACCGGACGGCCGTCTGCTGCGAGATCGGACAGGAAGAGGGCGGCGG
AACGCGCAAGGATCCCCTCAAGGCCATGCAGTGGTATCGAAGAGCGGCGACGCTGGGCGATCCGCCGGCCATGTA
CAAGGTGGGCATGATCCTGCTCAAGGGTCTGCTGGGCCAGAACAAGAACCCGCGAGAGGCCGTCGGCTGGCTGAG
GAGGGCTGCCGAAAGAGCCAACGAGGAGAACCCGCACGCGCTGCACGAGCTGGGGCTTCTATACGAGTCGGCGCA
GTCCAACGACGTCATCATCCGCGACGAGCGCTACGCCCTCAGCCTCTTCCAGGACGCGGCCGATCTGGGCTACAA
GTTCTCGCAGTTCCGGCTCGGCTGCGCGTTCGAGTACGGCCTCATGGGCTGTCCGATCGACCCGCGTCAGTCCAT
CTTCTGGTACTCCAAGGCGGCGGCCCAGGCCGAGCACCAGTCGGAGCTGGCCCTGAGCGGCTGGTACCTGACGGG
CAGCGACGGCGTGCTGGGCCAGAGCGACACCGAGGCTTACCTCTGGGCGCGCAAGGCTGCCGTTGCAGGGCTGGC
CAAGGCTGAGTATGCCATGGGCTACTTTACCGAGGTCGGCATCGGGGTGCCGGCGAACTTGGAGGATGCGAAGCG
GTGGTACTGGCGGGCAGCTGGTCAGCGTCTCTTGTCCCTTGTTTTTCTGTCTCTGTTCGACGGCTGACGGCGGTT
TCTCATAGCCCAGGAGTTTCCCAAGGCACGCGAGAGGCTCGAGGATCTCAAGCGCGCGGGCAAACACGGGCGTCC
ACGCGAGCGAGAGCGCATTTCCAGGAGTCGGATCGAGCGTCAGCAGGAGGGCGAGTGCAGCGTAATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail