Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3121
Gene name
LocationContig_279:9144..9871
Strand+
Gene length (bp)727
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup81
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5285
Ophiocordyceps australis 1348a (Ghana) OphauG2|6783
Ophiocordyceps australis map64 (Brazil) OphauB2|3223
Ophiocordyceps australis map64 (Brazil) OphauB2|5049
Ophiocordyceps australis map64 (Brazil) OphauB2|5050
Ophiocordyceps australis map64 (Brazil) OphauB2|6225
Ophiocordyceps camponoti-floridani Ophcf2|03522
Ophiocordyceps camponoti-floridani Ophcf2|06147
Ophiocordyceps camponoti-rufipedis Ophun1|3121 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4618
Ophiocordyceps kimflemingae Ophio5|1911
Ophiocordyceps kimflemingae Ophio5|8477
Ophiocordyceps subramaniannii Hirsu2|184
Ophiocordyceps subramaniannii Hirsu2|7612
Ophiocordyceps subramaniannii Hirsu2|7613

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3121
MRRVTVLFPLVTKAMSLATAPIEGYQVFIPSWEIELSPSGPTTTLNGTVEQVYQQAIKLNSNYEKESLAATAATA
VTAGPSKLAQEELALLVTDWNIATSLCGGKWQATSVRRVREGIGYLRRVRGQPNSQAGPSRCGRVSCAYNSAIWW
CNDDRRPKALNSFAAIADGAQLLVKRCVEWMNPQPEAFGGQAFHPTGWNVIIRQDNC*
Coding >Ophun1|3121
ATGAGGAGAGTCACGGTCCTGTTCCCTCTCGTCACCAAGGCCATGAGCCTCGCCACCGCCCCAATAGAAGGCTAC
CAAGTCTTCATCCCCTCATGGGAAATAGAGCTCTCCCCCAGCGGACCAACAACAACGCTCAACGGCACCGTCGAA
CAAGTCTACCAGCAAGCCATCAAGCTAAACTCAAACTACGAGAAAGAAAGCCTAGCGGCAACAGCGGCAACAGCA
GTAACAGCCGGTCCATCCAAGCTGGCCCAGGAAGAACTCGCCCTCCTGGTAACCGACTGGAACATCGCCACCAGC
CTCTGCGGCGGAAAGTGGCAGGCTACGTCTGTGCGACGCGTCCGCGAGGGCATCGGATACCTGCGTCGCGTGCGT
GGACAGCCGAATAGCCAGGCTGGACCGTCGCGATGTGGCCGTGTGAGTTGTGCCTATAACTCGGCCATCTGGTGG
TGCAACGACGATCGTCGTCCCAAGGCGCTCAACTCGTTTGCTGCTATTGCTGATGGGGCACAGCTGCTGGTTAAG
AGGTGTGTTGAGTGGATGAATCCCCAGCCCGAGGCTTTTGGCGGCCAGGCCTTTCACCCGACGGGCTGGAACGTC
ATTATCCGCCAGGATAATTGTTGA
Transcript >Ophun1|3121
ATGAGGAGAGTCACGGTCCTGTTCCCTCTCGTCACCAAGGCCATGAGCCTCGCCACCGCCCCAATAGAAGGCTAC
CAAGTCTTCATCCCCTCATGGGAAATAGAGCTCTCCCCCAGCGGACCAACAACAACGCTCAACGGCACCGTCGAA
CAAGTCTACCAGCAAGCCATCAAGCTAAACTCAAACTACGAGAAAGAAAGCCTAGCGGCAACAGCGGCAACAGCA
GTAACAGCCGGTCCATCCAAGCTGGCCCAGGAAGAACTCGCCCTCCTGGTAACCGACTGGAACATCGCCACCAGC
CTCTGCGGCGGAAAGTGGCAGGCTACGTCTGTGCGACGCGTCCGCGAGGGCATCGGATACCTGCGTCGCGTGCGT
GGACAGCCGAATAGCCAGGCTGGACCGTCGCGATGTGGCCGTGTGAGTTGTGCCTATAACTCGGCCATCTGGTGG
TGCAACGACGATCGTCGTCCCAAGGCGCTCAACTCGTTTGCTGCTATTGCTGATGGGGCACAGCTGCTGGTTAAG
AGGTGTGTTGAGTGGATGAATCCCCAGCCCGAGGCTTTTGGCGGCCAGGCCTTTCACCCGACGGGCTGGAACGTC
ATTATCCGCCAGGATAATTGTTGA
Gene >Ophun1|3121
ATGAGGAGAGTCACGGTCCTGTTCCCTCTCGTCACCAAGGTAAGTAACCCTGTCATCCCCAGCAGACACAATCAT
AACTCACAACTCCAGGCCATGAGCCTCGCCACCGCCCCAATAGAAGGCTACCAAGTCTTCATCCCCTCATGGGAA
ATAGAGCTCTCCCCCAGCGGACCAACAACAACGCTCAACGGCACCGTCGAACAAGTCTACCAGCAAGCCATCAAG
CTAAACTCAAACTACGAGAAAGAAAGCCTAGCGGCAACAGCGGCAACAGCAGTAACAGCCGGTCCATCCAAGCTG
GCCCAGGAAGAACTCGCCCTCCTGGTAACCGACTGGAACATCGCCACCAGCCTCTGCGGCGGAAAGTGGCAGGCT
ACGTCTGTGCGACGCGTCCGCGAGGGCATCGGATACCTGCGTCGCGTGCGTGGACAGCCGAATAGCCAGGCTGGA
CCGTCGCGATGTGGCCGTGTGAGTTGTGCCTATAACTCGGCCATCTGGTGGTGCAACGACGTGAGCATTCTCTTG
AGGTTCTCTTTGGGTTGAAGGCTGATGGTGGGTTTAGGATCGTCGTCCCAAGGCGCTCAACTCGTTTGCTGCTAT
TGCTGATGGGGCACAGCTGCTGGTTAAGAGGTGTGTTGAGTGGATGAATCCCCAGCCCGAGGCTTTTGGCGGCCA
GGCCTTTCACCCGACGGGCTGGAACGTCATTATCCGCCAGGATAATTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail