Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3118
Gene name
LocationContig_279:394..2909
Strand-
Gene length (bp)2515
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 6.5E-06 150 203
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 7.2E-10 321 392

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38741|RIM4_YEAST Meiotic activator RIM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM4 PE=1 SV=1 138 242 2.0E-08

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3850
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7277
Ophiocordyceps australis map64 (Brazil) OphauB2|5075
Ophiocordyceps camponoti-floridani Ophcf2|06145
Ophiocordyceps camponoti-rufipedis Ophun1|3118 (this protein)
Ophiocordyceps kimflemingae Ophio5|3768
Ophiocordyceps subramaniannii Hirsu2|7611

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3118
MPPPALRRPEKKPSLGHGLELDAMRKASSCEPFNNDMLNSSDDENYSGGAYCETASDSPLPGSKIRTRAQFRKPF
SDDGAPSTRLNNFLVGSSEDDDVFTVGSNDNLTHESSSRGVANDASYQDLRDKVDPQTMYAGSSCMFVANDRRLE
EEVTKNFSQFGIVFVKIKRDSRGMPFAFCQYTNDEDAHSALRQGRGIMIFERPCRTEMARAHSSFLVFKVSGQRI
RLYEARDLLRRLGEISKTEYLNDALRALAQLPQAVVVTYKMYDAKRDPVKAFELDPVYRVQVYDPKALAAQETLQ
VGAPREGSFLKKYDKDRRSAYVGNLPPTMTRDVLKSLATSCGEVLDVQLHSRDVPGGAGAKTCFGFIEFSRPDAP
DELVEAMHNTQIDGYRVRAERKQSRGIETPRYGPSPARYANGRGRVGSFELEKPAEGHFDTPVENSGRQNRRKLY
ASSSFTPGRNRAPRPSVLGPDASPFRGIFEPQEGAALNMPAKSPRANRTPLQGPSAKKSVEFDLARRGVSGASDD
AGVGIESNTKPTTPKSSGASTASYGRTFRESETMSTAQTTMPQWIQPYGAFGYPYMGTPMTPQANPGLMYAGYMQ
HPMYHTMCDMYGNFMMSPTHMMPAFNATPPVMNETPVRSDHGGNVADETVVMPKAKDEAEAEKEEPTQ*
Coding >Ophun1|3118
ATGCCGCCTCCTGCTTTGCGTCGGCCTGAGAAGAAGCCGTCTCTGGGACACGGCTTGGAGCTGGATGCCATGCGC
AAGGCGTCCTCTTGCGAGCCCTTCAACAACGACATGTTGAACTCGTCCGACGACGAGAACTATTCTGGAGGAGCT
TATTGCGAGACCGCGAGCGACAGTCCTTTGCCCGGTTCAAAGATTCGGACCAGAGCTCAGTTCAGAAAGCCCTTC
TCTGATGACGGCGCCCCTTCGACACGCTTGAACAACTTCCTTGTCGGTTCCAGCGAGGATGACGATGTCTTTACC
GTCGGCTCAAACGACAACTTGACTCACGAGTCGAGTTCTCGTGGCGTGGCCAACGATGCCTCCTACCAGGACTTG
CGCGACAAGGTCGATCCGCAGACCATGTATGCCGGCTCGTCTTGCATGTTTGTGGCCAATGACCGACGACTGGAG
GAAGAGGTCACCAAGAACTTTAGCCAGTTTGGCATCGTCTTTGTCAAGATCAAGCGCGACTCGCGTGGCATGCCC
TTTGCATTTTGCCAGTACACGAACGATGAAGACGCACACTCGGCCTTGAGACAGGGCAGAGGCATAATGATCTTC
GAACGTCCTTGCCGCACGGAGATGGCCAGAGCCCATTCTTCTTTCCTCGTCTTCAAAGTCTCGGGACAGCGCATC
CGCCTCTACGAAGCGCGTGATCTGCTTCGCCGTCTCGGTGAAATCTCAAAGACTGAGTATCTCAACGACGCGCTC
CGAGCCCTTGCGCAGCTTCCTCAGGCCGTCGTCGTGACGTACAAGATGTACGATGCGAAACGCGACCCTGTCAAG
GCATTTGAGCTCGACCCGGTTTACCGCGTCCAGGTTTACGACCCAAAGGCACTTGCCGCCCAGGAAACTCTCCAG
GTGGGCGCTCCTCGCGAGGGCAGCTTTCTCAAAAAGTACGACAAAGACCGACGATCGGCCTACGTCGGCAACTTG
CCGCCCACCATGACCCGAGACGTTCTCAAATCGCTCGCTACCTCGTGCGGAGAGGTTTTGGACGTCCAGCTTCAT
AGCAGAGACGTACCGGGAGGAGCAGGCGCCAAGACCTGCTTTGGATTTATCGAGTTCAGTCGTCCGGATGCTCCC
GATGAGCTCGTCGAGGCCATGCACAATACGCAGATTGACGGTTACCGAGTCCGAGCCGAACGAAAGCAATCGCGA
GGCATAGAGACTCCGCGCTATGGTCCGTCTCCAGCCCGATACGCCAACGGGCGCGGGCGCGTCGGCTCCTTTGAG
CTCGAAAAGCCAGCCGAGGGCCATTTCGATACGCCCGTCGAGAATTCGGGCAGACAGAATCGTCGGAAGCTCTAC
GCCTCGAGCTCGTTTACGCCGGGACGCAACCGAGCCCCTCGTCCCTCGGTCTTGGGCCCCGACGCATCGCCGTTT
CGCGGCATCTTTGAGCCTCAGGAGGGGGCAGCCTTGAACATGCCGGCCAAGTCGCCGCGGGCCAACCGAACGCCT
CTGCAGGGCCCTTCTGCCAAAAAGTCGGTCGAGTTCGACTTGGCTCGTCGTGGCGTCTCGGGCGCCTCTGATGAC
GCGGGTGTTGGCATCGAGTCCAACACCAAGCCGACGACACCCAAGTCCAGCGGCGCATCAACGGCTTCGTATGGC
CGCACGTTCAGAGAGAGCGAGACGATGTCGACGGCTCAGACGACGATGCCGCAGTGGATTCAGCCGTACGGAGCA
TTCGGATACCCTTATATGGGAACGCCCATGACTCCTCAGGCCAATCCGGGACTCATGTATGCCGGCTACATGCAG
CATCCCATGTATCATACCATGTGCGATATGTACGGCAACTTTATGATGTCGCCGACTCACATGATGCCCGCCTTC
AACGCCACGCCGCCCGTCATGAACGAGACGCCAGTCCGATCGGATCACGGCGGCAACGTCGCTGACGAGACGGTG
GTCATGCCCAAGGCCAAGGACGAAGCGGAGGCAGAGAAAGAGGAGCCGACGCAGTGA
Transcript >Ophun1|3118
ATGCCGCCTCCTGCTTTGCGTCGGCCTGAGAAGAAGCCGTCTCTGGGACACGGCTTGGAGCTGGATGCCATGCGC
AAGGCGTCCTCTTGCGAGCCCTTCAACAACGACATGTTGAACTCGTCCGACGACGAGAACTATTCTGGAGGAGCT
TATTGCGAGACCGCGAGCGACAGTCCTTTGCCCGGTTCAAAGATTCGGACCAGAGCTCAGTTCAGAAAGCCCTTC
TCTGATGACGGCGCCCCTTCGACACGCTTGAACAACTTCCTTGTCGGTTCCAGCGAGGATGACGATGTCTTTACC
GTCGGCTCAAACGACAACTTGACTCACGAGTCGAGTTCTCGTGGCGTGGCCAACGATGCCTCCTACCAGGACTTG
CGCGACAAGGTCGATCCGCAGACCATGTATGCCGGCTCGTCTTGCATGTTTGTGGCCAATGACCGACGACTGGAG
GAAGAGGTCACCAAGAACTTTAGCCAGTTTGGCATCGTCTTTGTCAAGATCAAGCGCGACTCGCGTGGCATGCCC
TTTGCATTTTGCCAGTACACGAACGATGAAGACGCACACTCGGCCTTGAGACAGGGCAGAGGCATAATGATCTTC
GAACGTCCTTGCCGCACGGAGATGGCCAGAGCCCATTCTTCTTTCCTCGTCTTCAAAGTCTCGGGACAGCGCATC
CGCCTCTACGAAGCGCGTGATCTGCTTCGCCGTCTCGGTGAAATCTCAAAGACTGAGTATCTCAACGACGCGCTC
CGAGCCCTTGCGCAGCTTCCTCAGGCCGTCGTCGTGACGTACAAGATGTACGATGCGAAACGCGACCCTGTCAAG
GCATTTGAGCTCGACCCGGTTTACCGCGTCCAGGTTTACGACCCAAAGGCACTTGCCGCCCAGGAAACTCTCCAG
GTGGGCGCTCCTCGCGAGGGCAGCTTTCTCAAAAAGTACGACAAAGACCGACGATCGGCCTACGTCGGCAACTTG
CCGCCCACCATGACCCGAGACGTTCTCAAATCGCTCGCTACCTCGTGCGGAGAGGTTTTGGACGTCCAGCTTCAT
AGCAGAGACGTACCGGGAGGAGCAGGCGCCAAGACCTGCTTTGGATTTATCGAGTTCAGTCGTCCGGATGCTCCC
GATGAGCTCGTCGAGGCCATGCACAATACGCAGATTGACGGTTACCGAGTCCGAGCCGAACGAAAGCAATCGCGA
GGCATAGAGACTCCGCGCTATGGTCCGTCTCCAGCCCGATACGCCAACGGGCGCGGGCGCGTCGGCTCCTTTGAG
CTCGAAAAGCCAGCCGAGGGCCATTTCGATACGCCCGTCGAGAATTCGGGCAGACAGAATCGTCGGAAGCTCTAC
GCCTCGAGCTCGTTTACGCCGGGACGCAACCGAGCCCCTCGTCCCTCGGTCTTGGGCCCCGACGCATCGCCGTTT
CGCGGCATCTTTGAGCCTCAGGAGGGGGCAGCCTTGAACATGCCGGCCAAGTCGCCGCGGGCCAACCGAACGCCT
CTGCAGGGCCCTTCTGCCAAAAAGTCGGTCGAGTTCGACTTGGCTCGTCGTGGCGTCTCGGGCGCCTCTGATGAC
GCGGGTGTTGGCATCGAGTCCAACACCAAGCCGACGACACCCAAGTCCAGCGGCGCATCAACGGCTTCGTATGGC
CGCACGTTCAGAGAGAGCGAGACGATGTCGACGGCTCAGACGACGATGCCGCAGTGGATTCAGCCGTACGGAGCA
TTCGGATACCCTTATATGGGAACGCCCATGACTCCTCAGGCCAATCCGGGACTCATGTATGCCGGCTACATGCAG
CATCCCATGTATCATACCATGTGCGATATGTACGGCAACTTTATGATGTCGCCGACTCACATGATGCCCGCCTTC
AACGCCACGCCGCCCGTCATGAACGAGACGCCAGTCCGATCGGATCACGGCGGCAACGTCGCTGACGAGACGGTG
GTCATGCCCAAGGCCAAGGACGAAGCGGAGGCAGAGAAAGAGGAGCCGACGCAGTGA
Gene >Ophun1|3118
ATGCCGCCTCCTGCTTTGCGTCGGCCTGAGAAGAAGCCGTCTCTGGGACACGGCTTGGAGCTGGATGCCATGCGC
AAGGCGTCCTCTTGCGAGCCCTTCAACAACGACATGTTGAACTCGTCCGACGACGAGAACTATTCTGGAGGTGAG
TCGCCTCCTCTTCGCACCATCTCTTGCTTGTCCAGCATGTGACTGACACTTTCTCAGGAGCTTATTGCGAGACCG
CGAGCGACAGTCCTTTGCCCGGTTCAAAGATTCGGTAAGCCTTCGCCCTCATCTTTGACCATCGCGCTTCTGACA
TCTAGTAGGACCAGAGCTCAGTTCAGAAAGCCCTTCTCTGATGACGGCGCCCCTTCGACACGGTAAGAGGTTCCC
GCTCTTTTGTCTGACCAGACTTTGCTGACGTTCATCATCAGCTTGAACAACTTCCTTGTCGGTTCCAGCGAGGAT
GACGATGTCTTTACCGTCGGCTCAAACGACAACTTGACTCACGAGTCGAGTTCTCGTGGCGTGGCCAACGATGCC
TCCTACCAGGACTTGCGCGACAAGGTCGATCCGCAGACCATGTATGCCGGCTCGTCTTGCATGTTTGTGGCCAAG
TGAGTATCCCTCTCCCCGTCGACTGTATAGTCTAGCTCACGTCTTCAAGTCTTCCTCAGCAATTCAGTGACCGAC
GACTGGAGGAAGAGGTCACCAAGAACTTTAGCCAGTTTGGCATCGTCTTTGTCAAGATCAAGCGCGACTCGCGTG
GCATGCCCTTTGCATTTTGCCAGTACACGGTGAGCAAGCATCGTCGAATCCCAAAGGTCGGATCAAGCTGACCTT
TGCCAGAACGATGAAGACGCACACTCGGCCTTGAGACAGGGCAGAGGCATAATGATCTTCGAACGTCCTTGCCGC
ACGGAGATGGCCAGAGCCCATTGTGAGTTCACCTTGCCTCCCCTGACGGCCCGTCACTGACAAGGCTCGCTCAGC
TTCTTTCCTCGTCTTCAAAGTCTCGGGACAGCGCATCCGCCTCTACGAAGCGCGTGATCTGCTTCGCCGTCTCGG
TGAAATCTCAAAGACTGAGTATCTCAACGACGCGCTCCGAGCCCTTGCGCAGCTTCCTCAGGCCGTCGTCGTGAC
GTACAAGATGTACGATGCGAAACGCGACCCTGTCAAGGTGAGCCTTGAAGCTGGCTTTCCCCTCGTCTTGACGAC
TGGCTGACTGGACCGGAACACAGGCATTTGAGCTCGACCCGGTTTACCGCGTCCAGGTTTACGACCCAAAGGCAC
TTGCCGCCCAGGAAACTCTCCAGGTGGGCGCTCCTCGCGAGGGCAGCTTTCTCAAAAAGTACGACAAAGACCGAC
GATCGGCCTACGTCGGCAACTTGCCGCCCACCATGACCCGAGACGTTCTCAAATCGCTCGCTACCTCGTGCGGAG
AGGTTTTGGACGTCCAGCTTCATAGCAGAGACGTACCGGGAGGAGCAGGTGAGTGTCGAGAAACCAAGTCGCACC
TCTGTGAGCTTACTGACACGATTTTTAGGCGCCAAGACCTGCTTTGGATTTATCGAGTTCAGTCGTCCGGATGCT
CCCGATGAGCTCGTCGAGGCCATGGTGAGTTTGCCACCGAGTCTCGCCCTCTCTCGCATGAGCTAACATGCTTCT
GTAGCACAATACGCAGATTGACGGTTACCGAGTCCGAGCCGAACGAAAGCAATCGCGAGGCATAGAGACTCCGCG
CTATGGTCCGTCTCCAGCCCGATACGCCAACGGGCGCGGGCGCGTCGGCTCCTTTGAGCTCGAAAAGCCAGCCGA
GGGCCATTTCGATACGCCCGTCGAGAATTCGGGCAGACAGAATCGTCGGAAGCTCTACGCCTCGAGCTCGTTTAC
GCCGGGACGCAACCGAGCCCCTCGTCCCTCGGTCTTGGGCCCCGACGCATCGCCGTTTCGCGGCATCTTTGAGCC
TCAGGAGGGGGCAGCCTTGAACATGCCGGCCAAGTCGCCGCGGGCCAACCGAACGCCTCTGCAGGGCCCTTCTGC
CAAAAAGTCGGTCGAGTTCGACTTGGCTCGTCGTGGCGTCTCGGGCGCCTCTGATGACGCGGGTGTTGGCATCGA
GTCCAACACCAAGCCGACGACACCCAAGTCCAGCGGCGCATCAACGGCTTCGTATGGCCGCACGTTCAGAGAGAG
CGAGACGATGTCGACGGCTCAGACGACGATGCCGCAGTGGATTCAGCCGTACGGAGCATTCGGATACCCTTATAT
GGGAACGCCCATGACTCCTCAGGCCAATCCGGGACTCATGTATGCCGGCTACATGCAGCATCCCATGTATCATAC
CATGTGCGATATGTACGGCAACTTTATGATGTCGCCGACTCACATGATGCCCGCCTTCAACGCCACGCCGCCCGT
CATGAACGAGACGCCAGTCCGATCGGATCACGGCGGCAACGTCGCTGACGAGACGGTGGTCATGCCCAAGGCCAA
GGACGAAGCGGAGGCAGAGAAAGAGGAGCCGACGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail