Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3111
Gene name
LocationContig_277:21955..23099
Strand-
Gene length (bp)1144
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01182 Glucosamine_iso Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase 3.2E-21 8 223

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4FV08|GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus GN=GNPDA1 PE=2 SV=1 1 258 1.0E-127
sp|P46926|GNPI1_HUMAN Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens GN=GNPDA1 PE=1 SV=1 1 258 1.0E-126
sp|O88958|GNPI1_MOUSE Glucosamine-6-phosphate isomerase 1 OS=Mus musculus GN=Gnpda1 PE=1 SV=3 1 258 3.0E-126
sp|Q5R8T8|GNPI1_PONAB Glucosamine-6-phosphate isomerase 1 OS=Pongo abelii GN=GNPDA1 PE=2 SV=1 1 258 2.0E-125
sp|Q64422|GNPI1_MESAU Glucosamine-6-phosphate isomerase 1 OS=Mesocricetus auratus GN=GNPDA1 PE=2 SV=1 1 258 5.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4FV08|GNPI1_BOVIN Glucosamine-6-phosphate isomerase 1 OS=Bos taurus GN=GNPDA1 PE=2 SV=1 1 258 1.0E-127
sp|P46926|GNPI1_HUMAN Glucosamine-6-phosphate isomerase 1 OS=Homo sapiens GN=GNPDA1 PE=1 SV=1 1 258 1.0E-126
sp|O88958|GNPI1_MOUSE Glucosamine-6-phosphate isomerase 1 OS=Mus musculus GN=Gnpda1 PE=1 SV=3 1 258 3.0E-126
sp|Q5R8T8|GNPI1_PONAB Glucosamine-6-phosphate isomerase 1 OS=Pongo abelii GN=GNPDA1 PE=2 SV=1 1 258 2.0E-125
sp|Q64422|GNPI1_MESAU Glucosamine-6-phosphate isomerase 1 OS=Mesocricetus auratus GN=GNPDA1 PE=2 SV=1 1 258 5.0E-125
sp|A6L7Q8|NAGB_BACV8 Glucosamine-6-phosphate deaminase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=nagB PE=3 SV=1 1 260 4.0E-124
sp|A4IHW6|GNPI2_XENTR Glucosamine-6-phosphate isomerase 2 OS=Xenopus tropicalis GN=gnpda2 PE=2 SV=1 1 261 2.0E-123
sp|Q5TNH5|GNPI_ANOGA Glucosamine-6-phosphate isomerase OS=Anopheles gambiae GN=Gnpda1 PE=3 SV=3 1 269 3.0E-123
sp|A6LHV2|NAGB_PARD8 Glucosamine-6-phosphate deaminase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=nagB PE=3 SV=1 1 260 9.0E-123
sp|Q6PA43|GNPI2_XENLA Glucosamine-6-phosphate isomerase 2 OS=Xenopus laevis GN=gnpda2 PE=2 SV=1 1 261 4.0E-122
sp|Q8TDQ7|GNPI2_HUMAN Glucosamine-6-phosphate isomerase 2 OS=Homo sapiens GN=GNPDA2 PE=1 SV=1 1 261 5.0E-122
sp|Q9CRC9|GNPI2_MOUSE Glucosamine-6-phosphate isomerase 2 OS=Mus musculus GN=Gnpda2 PE=1 SV=1 1 261 6.0E-122
sp|Q16HW7|GNPI_AEDAE Glucosamine-6-phosphate isomerase OS=Aedes aegypti GN=Gnpda1 PE=3 SV=1 1 261 1.0E-121
sp|Q17QL1|GNPI2_BOVIN Glucosamine-6-phosphate isomerase 2 OS=Bos taurus GN=GNPDA2 PE=2 SV=1 1 261 2.0E-121
sp|Q29NT9|GNPI_DROPS Glucosamine-6-phosphate isomerase OS=Drosophila pseudoobscura pseudoobscura GN=Gnpda1 PE=3 SV=1 1 268 7.0E-120
sp|B2RZL5|NAGB_BORHD Glucosamine-6-phosphate deaminase OS=Borrelia hermsii (strain HS1 / DAH) GN=nagB PE=3 SV=1 1 260 4.0E-119
sp|Q9VMP9|GNPI_DROME Glucosamine-6-phosphate isomerase OS=Drosophila melanogaster GN=Gnpda1 PE=2 SV=1 1 258 8.0E-118
sp|Q64XP2|NAGB_BACFR Glucosamine-6-phosphate deaminase OS=Bacteroides fragilis (strain YCH46) GN=nagB PE=3 SV=1 1 259 1.0E-117
sp|Q5LGU0|NAGB_BACFN Glucosamine-6-phosphate deaminase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=nagB PE=3 SV=1 1 259 1.0E-117
sp|Q8A094|NAGB_BACTN Glucosamine-6-phosphate deaminase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=nagB PE=3 SV=1 1 259 3.0E-117
sp|B2RJ01|NAGB_PORG3 Glucosamine-6-phosphate deaminase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=nagB PE=3 SV=1 1 260 7.0E-116
sp|Q65QE8|NAGB_MANSM Glucosamine-6-phosphate deaminase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=nagB PE=3 SV=1 1 262 1.0E-115
sp|Q7MW43|NAGB_PORGI Glucosamine-6-phosphate deaminase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=nagB PE=3 SV=1 1 260 3.0E-115
sp|A0KIG3|NAGB_AERHH Glucosamine-6-phosphate deaminase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=nagB PE=3 SV=1 1 259 6.0E-115
sp|B5XZG9|NAGB_KLEP3 Glucosamine-6-phosphate deaminase OS=Klebsiella pneumoniae (strain 342) GN=nagB PE=3 SV=1 1 259 2.0E-114
sp|A8AJE0|NAGB_CITK8 Glucosamine-6-phosphate deaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|Q8ZQX7|NAGB_SALTY Glucosamine-6-phosphate deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B4TPZ8|NAGB_SALSV Glucosamine-6-phosphate deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B5BCC5|NAGB_SALPK Glucosamine-6-phosphate deaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|C0PWA5|NAGB_SALPC Glucosamine-6-phosphate deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|A9MUG8|NAGB_SALPB Glucosamine-6-phosphate deaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|Q5PCH6|NAGB_SALPA Glucosamine-6-phosphate deaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B4SYN7|NAGB_SALNS Glucosamine-6-phosphate deaminase OS=Salmonella newport (strain SL254) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B4TB82|NAGB_SALHS Glucosamine-6-phosphate deaminase OS=Salmonella heidelberg (strain SL476) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B5R824|NAGB_SALG2 Glucosamine-6-phosphate deaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B5QWC8|NAGB_SALEP Glucosamine-6-phosphate deaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B5FNB9|NAGB_SALDC Glucosamine-6-phosphate deaminase OS=Salmonella dublin (strain CT_02021853) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|Q57RQ0|NAGB_SALCH Glucosamine-6-phosphate deaminase OS=Salmonella choleraesuis (strain SC-B67) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|B5EZC1|NAGB_SALA4 Glucosamine-6-phosphate deaminase OS=Salmonella agona (strain SL483) GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|Q8Z8G0|NAGB_SALTI Glucosamine-6-phosphate deaminase OS=Salmonella typhi GN=nagB PE=3 SV=1 1 259 3.0E-114
sp|A9MKA9|NAGB_SALAR Glucosamine-6-phosphate deaminase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=nagB PE=3 SV=1 1 259 4.0E-114
sp|A6T6C1|NAGB_KLEP7 Glucosamine-6-phosphate deaminase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=nagB PE=3 SV=1 1 259 7.0E-114
sp|Q8FJX7|NAGB_ECOL6 Glucosamine-6-phosphate deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nagB PE=3 SV=1 1 259 1.0E-113
sp|A7MQT6|NAGB_CROS8 Glucosamine-6-phosphate deaminase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nagB PE=3 SV=1 1 259 2.0E-113
sp|A4SPM2|NAGB_AERS4 Glucosamine-6-phosphate deaminase OS=Aeromonas salmonicida (strain A449) GN=nagB PE=3 SV=1 1 259 4.0E-113
sp|Q3Z4C2|NAGB_SHISS Glucosamine-6-phosphate deaminase OS=Shigella sonnei (strain Ss046) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|Q324M6|NAGB_SHIBS Glucosamine-6-phosphate deaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B2TU53|NAGB_SHIB3 Glucosamine-6-phosphate deaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7LKT5|NAGB_ESCF3 Glucosamine-6-phosphate deaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|Q1REP9|NAGB_ECOUT Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B1LLC0|NAGB_ECOSM Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B6HYN6|NAGB_ECOSE Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain SE11) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7N9S4|NAGB_ECOLU Glucosamine-6-phosphate deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|P0A759|NAGB_ECOLI Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain K12) GN=nagB PE=1 SV=1 1 259 6.0E-113
sp|B1IY50|NAGB_ECOLC Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|Q0TK13|NAGB_ECOL5 Glucosamine-6-phosphate deaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|A1A8T7|NAGB_ECOK1 Glucosamine-6-phosphate deaminase OS=Escherichia coli O1:K1 / APEC GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|A7ZXT7|NAGB_ECOHS Glucosamine-6-phosphate deaminase OS=Escherichia coli O9:H4 (strain HS) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B1X6L1|NAGB_ECODH Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain K12 / DH10B) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|C4ZWF4|NAGB_ECOBW Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7M5J6|NAGB_ECO8A Glucosamine-6-phosphate deaminase OS=Escherichia coli O8 (strain IAI1) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7MPI3|NAGB_ECO81 Glucosamine-6-phosphate deaminase OS=Escherichia coli O81 (strain ED1a) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7NMM9|NAGB_ECO7I Glucosamine-6-phosphate deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B5YQM0|NAGB_ECO5E Glucosamine-6-phosphate deaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|P0A760|NAGB_ECO57 Glucosamine-6-phosphate deaminase OS=Escherichia coli O157:H7 GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7L9L4|NAGB_ECO55 Glucosamine-6-phosphate deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7MFT4|NAGB_ECO45 Glucosamine-6-phosphate deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|B7UKV0|NAGB_ECO27 Glucosamine-6-phosphate deaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|A7ZJ60|NAGB_ECO24 Glucosamine-6-phosphate deaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|P59688|NAGB_SHIFL Glucosamine-6-phosphate deaminase OS=Shigella flexneri GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|Q0T6S6|NAGB_SHIF8 Glucosamine-6-phosphate deaminase OS=Shigella flexneri serotype 5b (strain 8401) GN=nagB PE=3 SV=1 1 259 6.0E-113
sp|A4W844|NAGB_ENT38 Glucosamine-6-phosphate deaminase OS=Enterobacter sp. (strain 638) GN=nagB PE=3 SV=1 1 259 1.0E-112
sp|C5BGA6|NAGB_EDWI9 Glucosamine-6-phosphate deaminase OS=Edwardsiella ictaluri (strain 93-146) GN=nagB PE=3 SV=1 1 259 3.0E-112
sp|B0UUN2|NAGB_HISS2 Glucosamine-6-phosphate deaminase OS=Histophilus somni (strain 2336) GN=nagB PE=3 SV=1 1 262 1.0E-111
sp|B3GZ06|NAGB_ACTP7 Glucosamine-6-phosphate deaminase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=nagB PE=3 SV=1 1 262 1.0E-111
sp|A3N353|NAGB_ACTP2 Glucosamine-6-phosphate deaminase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=nagB PE=3 SV=1 1 262 1.0E-111
sp|Q32IQ2|NAGB_SHIDS Glucosamine-6-phosphate deaminase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nagB PE=3 SV=1 1 259 1.0E-111
sp|B8F877|NAGB_HAEPS Glucosamine-6-phosphate deaminase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=nagB PE=3 SV=1 1 263 2.0E-111
sp|Q9XVJ2|GNPI_CAEEL Probable glucosamine-6-phosphate isomerase OS=Caenorhabditis elegans GN=T03F6.3 PE=3 SV=1 1 258 2.0E-111
sp|Q0SP13|NAGB_BORAP Glucosamine-6-phosphate deaminase OS=Borrelia afzelii (strain PKo) GN=nagB PE=3 SV=1 1 260 3.0E-111
sp|B0BSS6|NAGB_ACTPJ Glucosamine-6-phosphate deaminase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=nagB PE=3 SV=1 1 262 4.0E-111
sp|B7VTI0|NAGB_VIBTL Glucosamine-6-phosphate deaminase OS=Vibrio tasmaniensis (strain LGP32) GN=nagB PE=3 SV=1 1 259 4.0E-111
sp|Q0I4B9|NAGB_HAES1 Glucosamine-6-phosphate deaminase OS=Haemophilus somnus (strain 129Pt) GN=nagB PE=3 SV=1 1 262 1.0E-110
sp|Q9CMF4|NAGB_PASMU Glucosamine-6-phosphate deaminase OS=Pasteurella multocida (strain Pm70) GN=nagB PE=3 SV=1 1 262 2.0E-110
sp|C3LWT7|NAGB_VIBCM Glucosamine-6-phosphate deaminase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=nagB PE=3 SV=1 1 259 8.0E-110
sp|Q9KKS5|NAGB_VIBCH Glucosamine-6-phosphate deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=nagB PE=1 SV=1 1 259 8.0E-110
sp|A5F125|NAGB_VIBC3 Glucosamine-6-phosphate deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=nagB PE=3 SV=1 1 259 8.0E-110
sp|B5FBU7|NAGB_VIBFM Glucosamine-6-phosphate deaminase OS=Vibrio fischeri (strain MJ11) GN=nagB PE=3 SV=1 1 267 1.0E-109
sp|Q5E294|NAGB_VIBF1 Glucosamine-6-phosphate deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=nagB PE=3 SV=1 1 267 1.0E-109
sp|B7J183|NAGB_BORBZ Glucosamine-6-phosphate deaminase OS=Borrelia burgdorferi (strain ZS7) GN=nagB PE=3 SV=1 1 260 1.0E-109
sp|O30564|NAGB_BORBU Glucosamine-6-phosphate deaminase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=nagB PE=1 SV=1 1 260 1.0E-109
sp|A7N5W3|NAGB_VIBCB Glucosamine-6-phosphate deaminase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=nagB PE=3 SV=1 1 259 2.0E-109
sp|Q87K60|NAGB_VIBPA Glucosamine-6-phosphate deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=nagB PE=3 SV=1 1 259 2.0E-109
sp|Q662L3|NAGB_BORBP Glucosamine-6-phosphate deaminase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=nagB PE=3 SV=1 1 260 3.0E-109
sp|B6EN78|NAGB_ALISL Glucosamine-6-phosphate deaminase OS=Aliivibrio salmonicida (strain LFI1238) GN=nagB PE=3 SV=1 1 259 1.0E-108
sp|A8GB41|NAGB_SERP5 Glucosamine-6-phosphate deaminase OS=Serratia proteamaculans (strain 568) GN=nagB PE=3 SV=1 1 259 2.0E-108
sp|Q7MGE1|NAGB_VIBVY Glucosamine-6-phosphate deaminase OS=Vibrio vulnificus (strain YJ016) GN=nagB PE=3 SV=1 1 259 2.0E-108
sp|Q8D4T9|NAGB_VIBVU Glucosamine-6-phosphate deaminase OS=Vibrio vulnificus (strain CMCP6) GN=nagB PE=3 SV=1 1 259 2.0E-108
sp|C6DBY4|NAGB_PECCP Glucosamine-6-phosphate deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=nagB PE=3 SV=1 1 259 3.0E-108
sp|B4ESJ0|NAGB_PROMH Glucosamine-6-phosphate deaminase OS=Proteus mirabilis (strain HI4320) GN=nagB PE=3 SV=1 1 264 3.0E-108
sp|Q6D7J9|NAGB_PECAS Glucosamine-6-phosphate deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nagB PE=3 SV=1 1 259 8.0E-108
sp|B2VBN5|NAGB_ERWT9 Glucosamine-6-phosphate deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nagB PE=3 SV=1 1 259 1.0E-107
sp|Q73QV6|NAGB_TREDE Glucosamine-6-phosphate deaminase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=nagB PE=3 SV=1 1 260 2.0E-107
sp|Q54XK9|GNPI_DICDI Glucosamine-6-phosphate isomerase OS=Dictyostelium discoideum GN=gnpda1 PE=3 SV=1 1 259 5.0E-107
sp|Q8REG1|NAGB_FUSNN Glucosamine-6-phosphate deaminase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=nagB PE=3 SV=1 1 260 1.0E-106
sp|Q7MB61|NAGB_PHOLL Glucosamine-6-phosphate deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nagB PE=3 SV=1 1 259 4.0E-106
sp|B1JG88|NAGB_YERPY Glucosamine-6-phosphate deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|Q66DC7|NAGB_YERPS Glucosamine-6-phosphate deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|A4TNY0|NAGB_YERPP Glucosamine-6-phosphate deaminase OS=Yersinia pestis (strain Pestoides F) GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|Q1CKN7|NAGB_YERPN Glucosamine-6-phosphate deaminase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|A9R7S4|NAGB_YERPG Glucosamine-6-phosphate deaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|Q8ZDE1|NAGB_YERPE Glucosamine-6-phosphate deaminase OS=Yersinia pestis GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|B2K8A2|NAGB_YERPB Glucosamine-6-phosphate deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|Q1C537|NAGB_YERPA Glucosamine-6-phosphate deaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nagB PE=3 SV=1 1 259 8.0E-105
sp|A1JQE8|NAGB_YERE8 Glucosamine-6-phosphate deaminase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nagB PE=3 SV=1 1 259 1.0E-104
sp|A7FKU3|NAGB_YERP3 Glucosamine-6-phosphate deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nagB PE=3 SV=1 1 259 2.0E-104
sp|P44538|NAGB_HAEIN Glucosamine-6-phosphate deaminase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=nagB PE=3 SV=1 1 259 2.0E-104
sp|A5UB10|NAGB_HAEIE Glucosamine-6-phosphate deaminase OS=Haemophilus influenzae (strain PittEE) GN=nagB PE=3 SV=1 1 259 3.0E-104
sp|Q4QP46|NAGB_HAEI8 Glucosamine-6-phosphate deaminase OS=Haemophilus influenzae (strain 86-028NP) GN=nagB PE=3 SV=1 1 259 5.0E-104
sp|Q7VKN1|NAGB_HAEDU Glucosamine-6-phosphate deaminase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=nagB PE=3 SV=1 1 259 1.0E-103
sp|C6C0A2|NAGB_DESAD Glucosamine-6-phosphate deaminase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=nagB PE=3 SV=1 15 259 7.0E-103
sp|C4L889|NAGB_TOLAT Glucosamine-6-phosphate deaminase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=nagB PE=3 SV=1 1 259 2.0E-102
sp|A1SS81|NAGB_PSYIN Glucosamine-6-phosphate deaminase OS=Psychromonas ingrahamii (strain 37) GN=nagB PE=3 SV=1 1 259 6.0E-99
sp|Q7VR99|NAGB_BLOFL Glucosamine-6-phosphate deaminase OS=Blochmannia floridanus GN=nagB PE=3 SV=1 1 259 9.0E-90
sp|Q04802|NAG1_CANAL Glucosamine-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NAG1 PE=1 SV=2 1 243 1.0E-71
sp|A0QU88|NAGB_MYCS2 Glucosamine-6-phosphate deaminase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nagB PE=1 SV=1 1 256 9.0E-62
sp|O31458|GAMA_BACSU Probable glucosamine-6-phosphate deaminase 2 OS=Bacillus subtilis (strain 168) GN=gamA PE=3 SV=1 1 248 3.0E-61
sp|Q8ESL6|NAGB_OCEIH Glucosamine-6-phosphate deaminase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=nagB PE=3 SV=1 1 243 5.0E-61
sp|Q2S6X5|NAGB_HAHCH Glucosamine-6-phosphate deaminase OS=Hahella chejuensis (strain KCTC 2396) GN=nagB PE=3 SV=1 1 259 2.0E-60
sp|A6VVU9|NAGB_MARMS Glucosamine-6-phosphate deaminase OS=Marinomonas sp. (strain MWYL1) GN=nagB PE=3 SV=1 1 260 2.0E-60
sp|A8FRI2|NAGB_SHESH Glucosamine-6-phosphate deaminase OS=Shewanella sediminis (strain HAW-EB3) GN=nagB PE=3 SV=1 1 259 6.0E-60
sp|C5BY94|NAGB_BEUC1 Glucosamine-6-phosphate deaminase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=nagB PE=3 SV=1 36 256 7.0E-60
sp|A3QB39|NAGB_SHELP Glucosamine-6-phosphate deaminase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=nagB PE=3 SV=1 1 259 1.0E-59
sp|B1KFS0|NAGB_SHEWM Glucosamine-6-phosphate deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nagB PE=3 SV=1 1 259 3.0E-59
sp|B8D185|NAGB_HALOH Glucosamine-6-phosphate deaminase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=nagB PE=3 SV=1 1 243 5.0E-59
sp|Q7UVM5|NAGB_RHOBA Glucosamine-6-phosphate deaminase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=nagB PE=3 SV=1 8 243 5.0E-59
sp|B0TTP5|NAGB_SHEHH Glucosamine-6-phosphate deaminase OS=Shewanella halifaxensis (strain HAW-EB4) GN=nagB PE=3 SV=1 1 259 4.0E-58
sp|Q8R5T0|NAGB_CALS4 Glucosamine-6-phosphate deaminase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=nagB PE=3 SV=1 36 243 2.0E-57
sp|B3PBV0|NAGB_CELJU Glucosamine-6-phosphate deaminase OS=Cellvibrio japonicus (strain Ueda107) GN=nagB PE=3 SV=1 1 260 3.0E-57
sp|Q9K487|NAGB_STRCO Glucosamine-6-phosphate deaminase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nagB PE=3 SV=1 1 256 4.0E-57
sp|Q5WHY0|NAGB_BACSK Glucosamine-6-phosphate deaminase OS=Bacillus clausii (strain KSM-K16) GN=nagB PE=3 SV=1 1 243 5.0E-57
sp|A0JY49|NAGB_ARTS2 Glucosamine-6-phosphate deaminase OS=Arthrobacter sp. (strain FB24) GN=nagB PE=3 SV=1 36 256 1.0E-56
sp|O97439|GNPI1_GIAIN Glucosamine-6-phosphate isomerase 1 OS=Giardia intestinalis GN=GPI1 PE=3 SV=1 36 243 1.0E-56
sp|Q487K8|NAGB_COLP3 Glucosamine-6-phosphate deaminase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=nagB PE=3 SV=1 1 248 3.0E-56
sp|A8MIX7|NAGB_ALKOO Glucosamine-6-phosphate deaminase OS=Alkaliphilus oremlandii (strain OhILAs) GN=nagB PE=3 SV=1 36 243 3.0E-56
sp|O97440|GNPI2_GIAIN Glucosamine-6-phosphate isomerase 2 OS=Giardia intestinalis GN=GPI2 PE=3 SV=1 36 247 4.0E-56
sp|P59689|NAGB_STRAW Glucosamine-6-phosphate deaminase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nagB PE=3 SV=1 1 256 6.0E-56
sp|B0K934|NAGB_THEP3 Glucosamine-6-phosphate deaminase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=nagB PE=3 SV=1 1 243 7.0E-56
sp|A6TVP5|NAGB_ALKMQ Glucosamine-6-phosphate deaminase OS=Alkaliphilus metalliredigens (strain QYMF) GN=nagB PE=3 SV=1 1 243 1.0E-55
sp|O35000|NAGB_BACSU Glucosamine-6-phosphate deaminase 1 OS=Bacillus subtilis (strain 168) GN=nagB PE=1 SV=1 20 243 1.0E-55
sp|B3DQQ9|NAGB_BIFLD Glucosamine-6-phosphate deaminase OS=Bifidobacterium longum (strain DJO10A) GN=nagB PE=3 SV=1 3 265 2.0E-55
sp|Q8G4N5|NAGB_BIFLO Glucosamine-6-phosphate deaminase OS=Bifidobacterium longum (strain NCC 2705) GN=nagB PE=3 SV=1 3 265 3.0E-55
sp|Q8XHP8|NAGB_CLOPE Glucosamine-6-phosphate deaminase OS=Clostridium perfringens (strain 13 / Type A) GN=nagB PE=3 SV=1 1 243 5.0E-55
sp|C0ZJF8|NAGB_BREBN Glucosamine-6-phosphate deaminase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=nagB PE=3 SV=1 1 247 6.0E-55
sp|Q0TML8|NAGB_CLOP1 Glucosamine-6-phosphate deaminase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=nagB PE=3 SV=1 1 243 8.0E-55
sp|B7GQA1|NAGB_BIFLS Glucosamine-6-phosphate deaminase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=nagB PE=3 SV=1 3 265 1.0E-54
sp|Q0SQB4|NAGB_CLOPS Glucosamine-6-phosphate deaminase OS=Clostridium perfringens (strain SM101 / Type A) GN=nagB PE=3 SV=1 1 243 1.0E-54
sp|B0K0J7|NAGB_THEPX Glucosamine-6-phosphate deaminase OS=Thermoanaerobacter sp. (strain X514) GN=nagB PE=3 SV=1 1 243 2.0E-54
sp|Q18AL0|NAGB_PEPD6 Glucosamine-6-phosphate deaminase OS=Peptoclostridium difficile (strain 630) GN=nagB PE=3 SV=1 1 253 2.0E-53
sp|C4LL80|NAGB_CORK4 Glucosamine-6-phosphate deaminase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=nagB PE=3 SV=1 36 260 2.0E-53
sp|Q890L6|NAGB_CLOTE Glucosamine-6-phosphate deaminase OS=Clostridium tetani (strain Massachusetts / E88) GN=nagB PE=3 SV=1 1 243 3.0E-53
sp|Q6NJ91|NAGB_CORDI Glucosamine-6-phosphate deaminase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=nagB PE=3 SV=1 36 256 4.0E-53
sp|A7GH51|NAGB_CLOBL Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=nagB PE=3 SV=1 1 250 6.0E-53
sp|B1IKY4|NAGB_CLOBK Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain Okra / Type B1) GN=nagB PE=3 SV=1 1 250 6.0E-53
sp|C1AW66|NAGB_RHOOB Glucosamine-6-phosphate deaminase OS=Rhodococcus opacus (strain B4) GN=nagB PE=3 SV=1 1 256 9.0E-53
sp|B1KZ07|NAGB_CLOBM Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=nagB PE=3 SV=1 1 250 2.0E-52
sp|Q0SGH6|NAGB_RHOJR Glucosamine-6-phosphate deaminase OS=Rhodococcus jostii (strain RHA1) GN=nagB PE=3 SV=1 1 256 3.0E-52
sp|A5I5R9|NAGB_CLOBH Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=nagB PE=3 SV=1 1 250 9.0E-52
sp|A7FX73|NAGB_CLOB1 Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=nagB PE=3 SV=1 1 250 9.0E-52
sp|B1HUU8|NAGB_LYSSC Glucosamine-6-phosphate deaminase OS=Lysinibacillus sphaericus (strain C3-41) GN=nagB PE=3 SV=1 36 238 2.0E-51
sp|Q97MK9|NAGB_CLOAB Glucosamine-6-phosphate deaminase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nagB PE=3 SV=1 1 243 2.0E-51
sp|Q6MSF4|NAGB_MYCMS Glucosamine-6-phosphate deaminase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=nagB PE=3 SV=1 1 247 2.0E-51
sp|Q9KFQ8|NAGB_BACHD Glucosamine-6-phosphate deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=nagB PE=3 SV=1 17 251 5.0E-51
sp|C5D3L0|NAGB_GEOSW Glucosamine-6-phosphate deaminase OS=Geobacillus sp. (strain WCH70) GN=nagB PE=3 SV=1 1 243 1.0E-50
sp|B2V163|NAGB_CLOBA Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=nagB PE=3 SV=1 1 253 1.0E-50
sp|C1FV12|NAGB_CLOBJ Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=nagB PE=3 SV=1 1 250 3.0E-50
sp|C3L2N7|NAGB_CLOB6 Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=nagB PE=3 SV=1 1 250 3.0E-50
sp|B2TL69|NAGB_CLOBB Glucosamine-6-phosphate deaminase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=nagB PE=3 SV=1 1 253 1.0E-49
sp|C4L2C5|NAGB_EXISA Glucosamine-6-phosphate deaminase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=nagB PE=3 SV=1 1 240 2.0E-49
sp|A7Z975|NAGB_BACMF Glucosamine-6-phosphate deaminase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=nagB PE=3 SV=1 36 243 2.0E-49
sp|B1VI88|NAGB_CORU7 Glucosamine-6-phosphate deaminase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=nagB PE=3 SV=1 37 248 1.0E-48
sp|B8HAX3|NAGB_ARTCA Glucosamine-6-phosphate deaminase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=nagB PE=3 SV=1 36 249 3.0E-48
sp|Q8CTR3|NAGB_STAES Glucosamine-6-phosphate deaminase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=nagB PE=3 SV=1 1 243 3.0E-47
sp|Q49VB6|NAGB_STAS1 Glucosamine-6-phosphate deaminase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=nagB PE=3 SV=1 12 243 4.0E-47
sp|A9NEX8|NAGB_ACHLI Glucosamine-6-phosphate deaminase OS=Acholeplasma laidlawii (strain PG-8A) GN=nagB PE=3 SV=1 24 243 9.0E-47
sp|C3PJW6|NAGB_CORA7 Glucosamine-6-phosphate deaminase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=nagB PE=3 SV=1 36 255 1.0E-46
sp|Q6AAI8|NAGB_PROAC Glucosamine-6-phosphate deaminase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nagB PE=3 SV=1 1 256 1.0E-46
sp|A9KIR8|NAGB_CLOPH Glucosamine-6-phosphate deaminase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=nagB PE=3 SV=1 36 239 2.0E-46
sp|Q5HRH8|NAGB_STAEQ Glucosamine-6-phosphate deaminase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=nagB PE=3 SV=1 1 243 4.0E-46
sp|A8FHS6|NAGB_BACP2 Glucosamine-6-phosphate deaminase OS=Bacillus pumilus (strain SAFR-032) GN=nagB PE=3 SV=1 36 243 7.0E-46
sp|Q8EWM7|NAGB_MYCPE Glucosamine-6-phosphate deaminase OS=Mycoplasma penetrans (strain HF-2) GN=nagB PE=3 SV=1 36 237 2.0E-45
sp|Q4L9T8|NAGB_STAHJ Glucosamine-6-phosphate deaminase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=nagB PE=3 SV=1 8 241 4.0E-45
sp|A6M241|NAGB_CLOB8 Glucosamine-6-phosphate deaminase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=nagB PE=3 SV=1 1 242 1.0E-44
sp|Q3ID09|NAGB_PSEHT Glucosamine-6-phosphate deaminase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=nagB PE=3 SV=1 1 264 7.0E-42
sp|A0PYW1|NAGB_CLONN Glucosamine-6-phosphate deaminase OS=Clostridium novyi (strain NT) GN=nagB PE=3 SV=1 36 247 7.0E-42
sp|Q98QJ9|NAGB_MYCPU Glucosamine-6-phosphate deaminase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=nagB PE=3 SV=1 1 258 1.0E-41
sp|Q8FMI6|NAGB_COREF Glucosamine-6-phosphate deaminase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=nagB PE=3 SV=2 1 261 1.0E-41
sp|B1YJ30|NAGB_EXIS2 Glucosamine-6-phosphate deaminase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=nagB PE=3 SV=1 32 243 1.0E-41
sp|Q8NMD4|NAGB_CORGL Glucosamine-6-phosphate deaminase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=nagB PE=3 SV=1 36 248 3.0E-41
sp|A8YTN8|NAGB_LACH4 Glucosamine-6-phosphate deaminase OS=Lactobacillus helveticus (strain DPC 4571) GN=nagB PE=3 SV=1 36 250 6.0E-41
sp|A4QH44|NAGB_CORGB Glucosamine-6-phosphate deaminase OS=Corynebacterium glutamicum (strain R) GN=nagB PE=3 SV=1 36 248 1.0E-40
sp|A7GS78|NAGB_BACCN Glucosamine-6-phosphate deaminase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=nagB PE=3 SV=1 28 243 3.0E-40
sp|Q04G36|NAGB_OENOB Glucosamine-6-phosphate deaminase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=nagB PE=3 SV=1 36 250 9.0E-40
sp|Q2YS95|NAGB_STAAB Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=nagB PE=3 SV=1 1 244 1.0E-39
sp|Q6GJA0|NAGB_STAAR Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain MRSA252) GN=nagB PE=3 SV=1 1 244 1.0E-39
sp|P65513|NAGB_STAAW Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain MW2) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|A8YZR7|NAGB_STAAT Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|Q6GBR8|NAGB_STAAS Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain MSSA476) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|P99125|NAGB_STAAN Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain N315) GN=nagB PE=1 SV=1 1 244 2.0E-39
sp|P65512|NAGB_STAAM Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|A6QEM2|NAGB_STAAE Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain Newman) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|Q5HIA6|NAGB_STAAC Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain COL) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|A5IQC3|NAGB_STAA9 Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain JH9) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|Q2G0K8|NAGB_STAA8 Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain NCTC 8325) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|Q2FJ71|NAGB_STAA3 Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain USA300) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|A6TZ46|NAGB_STAA2 Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain JH1) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|A7WZ06|NAGB_STAA1 Glucosamine-6-phosphate deaminase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=nagB PE=3 SV=1 1 244 2.0E-39
sp|Q6HEB2|NAGB_BACHK Glucosamine-6-phosphate deaminase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|Q635M6|NAGB_BACCZ Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain ZK / E33L) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|B9IWR7|NAGB_BACCQ Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain Q1) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|B7HN32|NAGB_BACC7 Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain AH187) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|C1EQS8|NAGB_BACC3 Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain 03BB102) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|Q731P4|NAGB_BACC1 Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|B7JL33|NAGB_BACC0 Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain AH820) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|Q81MH5|NAGB_BACAN Glucosamine-6-phosphate deaminase OS=Bacillus anthracis GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|A0RI59|NAGB_BACAH Glucosamine-6-phosphate deaminase OS=Bacillus thuringiensis (strain Al Hakam) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|C3LIR9|NAGB_BACAC Glucosamine-6-phosphate deaminase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|C3P761|NAGB_BACAA Glucosamine-6-phosphate deaminase OS=Bacillus anthracis (strain A0248) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|Q819D1|NAGB_BACCR Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|B7H945|NAGB_BACC4 Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain B4264) GN=nagB PE=3 SV=1 30 243 4.0E-39
sp|B7IWG6|NAGB_BACC2 Glucosamine-6-phosphate deaminase OS=Bacillus cereus (strain G9842) GN=nagB PE=3 SV=1 30 243 1.0E-38
sp|Q74HC4|NAGB_LACJO Glucosamine-6-phosphate deaminase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=nagB PE=3 SV=1 36 250 1.0E-38
sp|A9VFF7|NAGB_BACWK Glucosamine-6-phosphate deaminase OS=Bacillus weihenstephanensis (strain KBAB4) GN=nagB PE=3 SV=1 24 243 2.0E-38
sp|Q047I3|NAGB_LACDB Glucosamine-6-phosphate deaminase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=nagB PE=3 SV=1 37 243 2.0E-38
sp|Q1G817|NAGB_LACDA Glucosamine-6-phosphate deaminase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=nagB PE=3 SV=1 37 243 2.0E-38
sp|Q5FHT1|NAGB_LACAC Glucosamine-6-phosphate deaminase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=nagB PE=3 SV=1 36 250 6.0E-38
sp|B1MX39|NAGB_LEUCK Glucosamine-6-phosphate deaminase OS=Leuconostoc citreum (strain KM20) GN=nagB PE=3 SV=1 36 247 4.0E-37
sp|B9DWG4|NAGB_STRU0 Glucosamine-6-phosphate deaminase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=nagB PE=3 SV=1 37 247 1.0E-36
sp|Q03Z95|NAGB_LEUMM Glucosamine-6-phosphate deaminase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=nagB PE=3 SV=1 36 247 1.0E-35
sp|Q38YK9|NAGB_LACSS Glucosamine-6-phosphate deaminase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=nagB PE=3 SV=1 36 243 2.0E-35
sp|P65515|NAGB_STRA5 Glucosamine-6-phosphate deaminase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=nagB PE=3 SV=1 37 247 1.0E-34
sp|P65514|NAGB_STRA3 Glucosamine-6-phosphate deaminase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=nagB PE=3 SV=1 37 247 1.0E-34
sp|Q3K1Q7|NAGB_STRA1 Glucosamine-6-phosphate deaminase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=nagB PE=3 SV=1 37 247 1.0E-34
sp|A3CLX4|NAGB_STRSV Glucosamine-6-phosphate deaminase OS=Streptococcus sanguinis (strain SK36) GN=nagB PE=3 SV=1 36 243 2.0E-34
sp|Q03LS1|NAGB_STRTD Glucosamine-6-phosphate deaminase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=nagB PE=3 SV=1 37 247 2.0E-34
sp|C0MCU1|NAGB_STRS7 Glucosamine-6-phosphate deaminase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=nagB PE=3 SV=1 37 247 3.0E-34
sp|A5VKB2|NAGB_LACRD Glucosamine-6-phosphate deaminase OS=Lactobacillus reuteri (strain DSM 20016) GN=nagB PE=3 SV=1 36 247 3.0E-34
sp|C0M970|NAGB_STRE4 Glucosamine-6-phosphate deaminase OS=Streptococcus equi subsp. equi (strain 4047) GN=nagB PE=3 SV=1 37 247 4.0E-34
sp|B4U206|NAGB_STREM Glucosamine-6-phosphate deaminase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=nagB PE=3 SV=1 37 247 5.0E-34
sp|Q92D64|NAGB_LISIN Glucosamine-6-phosphate deaminase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=nagB PE=3 SV=1 1 243 1.0E-33
sp|P59687|NAGB_ENTFA Glucosamine-6-phosphate deaminase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=nagB PE=3 SV=1 36 247 1.0E-33
sp|Q5XBG4|NAGB_STRP6 Glucosamine-6-phosphate deaminase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=nagB PE=3 SV=2 37 247 1.0E-33
sp|Q8P0E0|NAGB_STRP8 Glucosamine-6-phosphate deaminase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=nagB PE=3 SV=1 37 247 1.0E-33
sp|B8DEH8|NAGB_LISMH Glucosamine-6-phosphate deaminase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=nagB PE=3 SV=1 1 243 1.0E-33
sp|Q1WS60|NAGB_LACS1 Glucosamine-6-phosphate deaminase OS=Lactobacillus salivarius (strain UCC118) GN=nagB PE=3 SV=1 36 243 3.0E-33
sp|Q8DV70|NAGB_STRMU Glucosamine-6-phosphate deaminase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=nagB PE=1 SV=1 37 243 3.0E-33
sp|A2RDX6|NAGB_STRPG Glucosamine-6-phosphate deaminase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=nagB PE=3 SV=1 37 247 5.0E-33
sp|P0DC67|NAGB_STRPQ Glucosamine-6-phosphate deaminase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=nagB PE=3 SV=1 37 247 6.0E-33
sp|P0DC66|NAGB_STRP3 Glucosamine-6-phosphate deaminase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=nagB PE=3 SV=1 37 247 6.0E-33
sp|Q02Y08|NAGB_LACLS Glucosamine-6-phosphate deaminase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=nagB PE=3 SV=1 37 243 6.0E-33
sp|A2RJR7|NAGB_LACLM Glucosamine-6-phosphate deaminase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=nagB PE=3 SV=1 37 243 6.0E-33
sp|Q8Y8E7|NAGB_LISMO Glucosamine-6-phosphate deaminase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=nagB PE=3 SV=1 1 243 8.0E-33
sp|B5XM45|NAGB_STRPZ Glucosamine-6-phosphate deaminase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=nagB PE=3 SV=1 37 247 9.0E-33
sp|Q721K9|NAGB_LISMF Glucosamine-6-phosphate deaminase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=nagB PE=3 SV=1 1 243 1.0E-32
sp|C1L1M8|NAGB_LISMC Glucosamine-6-phosphate deaminase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=nagB PE=3 SV=1 1 243 1.0E-32
sp|Q033M5|NAGB_LACC3 Glucosamine-6-phosphate deaminase OS=Lactobacillus casei (strain ATCC 334) GN=nagB PE=3 SV=1 36 250 1.0E-32
sp|Q8DPA1|NAGB_STRR6 Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=nagB PE=3 SV=2 37 243 1.0E-32
sp|C1C814|NAGB_STRP7 Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae (strain 70585) GN=nagB PE=3 SV=1 37 243 1.0E-32
sp|Q04JT5|NAGB_STRP2 Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=nagB PE=3 SV=1 37 243 1.0E-32
sp|C1CQU2|NAGB_STRZT Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|C1CLC3|NAGB_STRZP Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae (strain P1031) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|C1CF03|NAGB_STRZJ Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae (strain JJA) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|B8ZKX4|NAGB_STRPJ Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|B1ICL5|NAGB_STRPI Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|B5E5S3|NAGB_STRP4 Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|Q9CFA8|NAGB_LACLA Glucosamine-6-phosphate deaminase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|Q97Q16|NAGB_STRPN Glucosamine-6-phosphate deaminase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=nagB PE=3 SV=1 37 243 2.0E-32
sp|Q03H91|NAGB_PEDPA Glucosamine-6-phosphate deaminase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=nagB PE=3 SV=1 36 250 3.0E-32
sp|Q99Z50|NAGB_STRP1 Glucosamine-6-phosphate deaminase OS=Streptococcus pyogenes serotype M1 GN=nagB PE=3 SV=1 37 247 7.0E-32
sp|Q8AB53|Y258_BACTN Putative glucosamine-6-phosphate deaminase-like protein BT_0258 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=BT_0258 PE=3 SV=1 5 247 9.0E-32
sp|A4VU11|NAGB_STRSY Glucosamine-6-phosphate deaminase OS=Streptococcus suis (strain 05ZYH33) GN=nagB PE=3 SV=1 36 247 1.0E-31
sp|A4W0A3|NAGB_STRS2 Glucosamine-6-phosphate deaminase OS=Streptococcus suis (strain 98HAH33) GN=nagB PE=3 SV=1 36 247 1.0E-31
sp|P59686|NAGB_LYSSH Glucosamine-6-phosphate deaminase OS=Lysinibacillus sphaericus GN=nagB PE=2 SV=1 36 240 1.0E-31
sp|A8AYK4|NAGB_STRGC Glucosamine-6-phosphate deaminase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=nagB PE=3 SV=1 37 243 2.0E-30
sp|A0AH75|NAGB_LISW6 Glucosamine-6-phosphate deaminase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=nagB PE=3 SV=1 1 243 2.0E-29
sp|Q88ZS6|NAGB_LACPL Glucosamine-6-phosphate deaminase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=nagB PE=3 SV=1 36 250 3.0E-29
sp|P42912|AGAI_ECOLI Putative galactosamine-6-phosphate isomerase OS=Escherichia coli (strain K12) GN=agaI PE=3 SV=1 36 240 4.0E-17
sp|P31470|YIEK_ECOLI Uncharacterized protein YieK OS=Escherichia coli (strain K12) GN=yieK PE=3 SV=3 1 238 5.0E-11
sp|P74618|6PGL_SYNY3 6-phosphogluconolactonase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pgl PE=1 SV=3 37 212 2.0E-06
sp|Q84WW2|6PGL5_ARATH Probable 6-phosphogluconolactonase 5, chloroplastic OS=Arabidopsis thaliana GN=EMB2024 PE=2 SV=1 41 221 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5185
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3951
Ophiocordyceps australis map64 (Brazil) OphauB2|493
Ophiocordyceps camponoti-floridani Ophcf2|01229
Ophiocordyceps camponoti-rufipedis Ophun1|3111 (this protein)
Ophiocordyceps kimflemingae Ophio5|1730
Ophiocordyceps subramaniannii Hirsu2|3937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3111
MRLIIRDDAHAASSYVANYIVDRIKAFNPTPQHPFVLGLPTGSSPQGVYRILVEKFKAGLISFQHVVTFNMDEYV
GIPRDHAESYHSFMWKHFFSHVDIHPSNVHILDGNAPNLEAECVAYEDAIKAAGGIDLFLAGIGEDGHIAFNEPG
SSLASRTRVKTLAYDTILANSRFFDGDVDKVPRMALTVGVQTVLEAREVVVIILGQRKSLALQRCIEQGVNHMWT
LSSLQLHPHPMIVVDEDATLELQVKTVKYFKSIEKVAREAGFEQILPSKVRTGNGLVPTTKVDPVSSPTILSPQP
TTSQLLRATPATEYPIRSVSPDLVPDRMASRIPEPLLSTRLTPKPESQQIIRNANAISV*
Coding >Ophun1|3111
ATGCGGCTCATCATCCGTGACGACGCCCACGCGGCCAGCTCATACGTGGCCAACTACATCGTCGACCGCATCAAG
GCCTTCAACCCGACCCCCCAACACCCCTTCGTCCTCGGCCTGCCCACGGGGTCCAGTCCGCAGGGTGTATACCGC
ATCCTGGTGGAAAAGTTCAAGGCAGGACTCATCTCGTTTCAGCATGTCGTCACCTTCAATATGGACGAGTACGTC
GGCATCCCGCGCGACCACGCAGAGTCATACCACTCTTTCATGTGGAAGCACTTCTTCTCCCACGTCGACATCCAC
CCTTCCAACGTCCACATCCTCGACGGAAACGCGCCCAACCTCGAGGCCGAGTGCGTAGCCTACGAGGACGCCATC
AAGGCCGCCGGCGGCATCGACCTCTTCCTCGCCGGCATCGGAGAGGATGGCCATATCGCCTTCAACGAGCCCGGC
TCCAGCCTCGCCAGCCGAACGCGCGTCAAGACGCTCGCCTACGATACCATCCTCGCCAACTCGCGCTTCTTCGAC
GGCGATGTCGACAAGGTGCCCCGCATGGCCCTCACCGTCGGCGTCCAGACCGTCCTCGAGGCTCGCGAGGTCGTC
GTCATCATCCTCGGCCAGCGCAAGTCTCTCGCCCTTCAGCGCTGCATCGAGCAAGGCGTCAACCACATGTGGACC
CTGTCCAGCCTACAGCTGCATCCTCACCCCATGATTGTCGTTGACGAGGACGCCACGCTCGAGCTGCAGGTCAAG
ACTGTAAAGTACTTTAAGAGCATCGAAAAGGTCGCCCGCGAGGCCGGCTTCGAGCAGATCCTCCCCTCCAAAGTC
CGCACCGGCAACGGCCTCGTCCCCACGACAAAAGTCGATCCCGTCTCATCACCCACGATCCTCTCCCCCCAACCC
ACCACCTCACAGCTCCTCCGCGCCACTCCCGCCACCGAATATCCCATCCGCTCCGTCTCCCCCGACCTCGTCCCG
GATCGCATGGCCTCGCGCATCCCCGAGCCTCTCCTCAGCACCCGGCTGACGCCCAAACCGGAGTCGCAGCAGATC
ATCCGAAATGCCAACGCCATCAGCGTTTGA
Transcript >Ophun1|3111
ATGCGGCTCATCATCCGTGACGACGCCCACGCGGCCAGCTCATACGTGGCCAACTACATCGTCGACCGCATCAAG
GCCTTCAACCCGACCCCCCAACACCCCTTCGTCCTCGGCCTGCCCACGGGGTCCAGTCCGCAGGGTGTATACCGC
ATCCTGGTGGAAAAGTTCAAGGCAGGACTCATCTCGTTTCAGCATGTCGTCACCTTCAATATGGACGAGTACGTC
GGCATCCCGCGCGACCACGCAGAGTCATACCACTCTTTCATGTGGAAGCACTTCTTCTCCCACGTCGACATCCAC
CCTTCCAACGTCCACATCCTCGACGGAAACGCGCCCAACCTCGAGGCCGAGTGCGTAGCCTACGAGGACGCCATC
AAGGCCGCCGGCGGCATCGACCTCTTCCTCGCCGGCATCGGAGAGGATGGCCATATCGCCTTCAACGAGCCCGGC
TCCAGCCTCGCCAGCCGAACGCGCGTCAAGACGCTCGCCTACGATACCATCCTCGCCAACTCGCGCTTCTTCGAC
GGCGATGTCGACAAGGTGCCCCGCATGGCCCTCACCGTCGGCGTCCAGACCGTCCTCGAGGCTCGCGAGGTCGTC
GTCATCATCCTCGGCCAGCGCAAGTCTCTCGCCCTTCAGCGCTGCATCGAGCAAGGCGTCAACCACATGTGGACC
CTGTCCAGCCTACAGCTGCATCCTCACCCCATGATTGTCGTTGACGAGGACGCCACGCTCGAGCTGCAGGTCAAG
ACTGTAAAGTACTTTAAGAGCATCGAAAAGGTCGCCCGCGAGGCCGGCTTCGAGCAGATCCTCCCCTCCAAAGTC
CGCACCGGCAACGGCCTCGTCCCCACGACAAAAGTCGATCCCGTCTCATCACCCACGATCCTCTCCCCCCAACCC
ACCACCTCACAGCTCCTCCGCGCCACTCCCGCCACCGAATATCCCATCCGCTCCGTCTCCCCCGACCTCGTCCCG
GATCGCATGGCCTCGCGCATCCCCGAGCCTCTCCTCAGCACCCGGCTGACGCCCAAACCGGAGTCGCAGCAGATC
ATCCGAAATGCCAACGCCATCAGCGTTTGA
Gene >Ophun1|3111
ATGCGGCTCATCATCCGTGACGACGCCCACGCGGCCAGCTCATACGTGGCCAACTACATCGTCGACCGCATCAAG
GCCTTCAACCCGACCCCCCAACACCCCTTCGTCCTCGGCCTGCCCACGGGGTCCAGTCCGCAGGGTGTATACCGC
ATCCTGGTGGAAAAGTTCAAGGCAGGACTCATCTCGTTTCAGCATGTCGTCACCTTCAATATGGACGAGTACGTC
GGCATCCCGCGCGACCACGCAGAGTCATACCACTCTTTCATGTGGAAGCACTTCTTCTCCCACGTCGACATCCAC
CCTTCCAACGTCCACATCCTCGACGGAAACGCGCCCAACCTCGAGGCCGAGTGCGTAGCCTACGAGGACGCCATC
AAGGCCGCCGGCGGCATCGACCTCTTCCTCGCCGGCATCGGAGAGGATGGCCATATCGCCTTCAACGAGCCCGGC
TCCAGCCTCGCCAGCCGAACGCGCGTCAAGACGCTCGCCTACGATACCATCCTCGCCAACTCGCGCTTCTTCGAC
GGCGATGTCGACAAGGTGCCCCGCATGGCCCTCACCGTCGGCGTCCAGACCGTCCTCGAGGCTCGCGAGGTCGTC
GTCATCATCCTCGGCCAGCGCAAGTCTCTCGCCCTTCAGCGCTGCATCGAGCAAGGCGTCAACCACATGTGGACC
CTGTCCAGCCTACAGCTGCATCCTCACCCCATGATTGTCGTTGACGAGGACGCCACGCTCGAGCTGCAGGTCAAG
ACTGTAAAGGTGCCTTTCACCCTTTATACTCCATCAGCTTCTTCATACCCTGACAAGACTAACACCCATCCAGTA
CTTTAAGAGCATCGAAAAGGTCGCCCGCGAGGCCGGCTTCGAGCAGATCCTCCCCTCCAAAGTCCGCACCGGCAA
CGGCCTCGTCCCCACGACAAAAGTCGATCCCGTCTCATCACCCACGATCCTCTCCCCCCAACCCACCACCTCACA
GCTCCTCCGCGCCACTCCCGCCACCGAATATCCCATCCGCTCCGTCTCCCCCGACCTCGTCCCGGATCGCATGGC
CTCGCGCATCCCCGAGCCTCTCCTCAGCACCCGGCTGACGCCCAAACCGGAGTCGCAGCAGATCATCCGAAATGC
CAACGCCATCAGCGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail