Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3107
Gene name
LocationContig_277:7001..9210
Strand+
Gene length (bp)2209
Transcript length (bp)1587
Coding sequence length (bp)1587
Protein length (aa) 529

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04191 PEMT Phospholipid methyltransferase 7.8E-31 413 513
PF00082 Peptidase_S8 Subtilase family 7.7E-09 63 270

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P05375|PEM2_YEAST Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPI3 PE=1 SV=1 323 520 5.0E-61
sp|O74827|CHO1_SCHPO Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cho1 PE=3 SV=1 347 518 7.0E-50
sp|Q7YRH6|PEMT_BOVIN Phosphatidylethanolamine N-methyltransferase OS=Bos taurus GN=PEMT PE=2 SV=1 351 516 4.0E-39
sp|Q61907|PEMT_MOUSE Phosphatidylethanolamine N-methyltransferase OS=Mus musculus GN=Pemt PE=1 SV=4 351 513 3.0E-37
sp|Q54SD5|PEM2_DICDI Putative phosphatidylethanolamine N-methyltransferase OS=Dictyostelium discoideum GN=pem2 PE=3 SV=1 340 511 3.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P05375|PEM2_YEAST Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OPI3 PE=1 SV=1 323 520 5.0E-61
sp|O74827|CHO1_SCHPO Phosphatidyl-N-methylethanolamine N-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cho1 PE=3 SV=1 347 518 7.0E-50
sp|Q7YRH6|PEMT_BOVIN Phosphatidylethanolamine N-methyltransferase OS=Bos taurus GN=PEMT PE=2 SV=1 351 516 4.0E-39
sp|Q61907|PEMT_MOUSE Phosphatidylethanolamine N-methyltransferase OS=Mus musculus GN=Pemt PE=1 SV=4 351 513 3.0E-37
sp|Q54SD5|PEM2_DICDI Putative phosphatidylethanolamine N-methyltransferase OS=Dictyostelium discoideum GN=pem2 PE=3 SV=1 340 511 3.0E-37
sp|Q9UBM1|PEMT_HUMAN Phosphatidylethanolamine N-methyltransferase OS=Homo sapiens GN=PEMT PE=1 SV=4 351 513 4.0E-30
sp|Q08388|PEMT_RAT Phosphatidylethanolamine N-methyltransferase OS=Rattus norvegicus GN=Pemt PE=1 SV=2 351 513 3.0E-28
sp|Q54H80|PEMTL_DICDI PEMT/PEM2 methyltransferase family protein OS=Dictyostelium discoideum GN=DDB_G0289645 PE=3 SV=1 351 517 2.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 374 393 19
2 413 435 22
3 472 494 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3107
MAPSKSAFDSKVILQTGSPRGRDLSIKLSRPSQTSSEAWFNKTQPLLDVLSPTPQETDDDYRRVKIAVIDTGISP
DHPLINDFIVKNFVETPNGRVRDDPKHGTDSIDLILTMLDTAKIYVARVFQAKEGDQLTPGYMAEVSRLPSGSLL
YVDIISISAGFEHSHAKLAEAIRRASAADPEILIFAAAANWANTQSVAYPARLTGQVFCMFSTNGALRNSRDFNP
NALDNADNFALLGQDVKLNPLSREGLSGTSIATAVAAGLAGRIIDFTRHADSRGHLTQQHRNKVASKLGLREIFH
FMSQDHKDLEYRCVAPWELLPPEEMSAPTQHREDTRSKICGTIERALWKLNIVARQEYHKKLLTKLFGGNSRHAC
YALAATIFSLGLVRDWLYKQAIQEQPSHALLLTPASRLAGISLLVAGNVLVLSSTWALGITGTFLGDYFGILMDD
MVTGFPFNVCGAPMYWGSTMSFLGTALLLGKPAGVFITAWVYIVYCAALRYEDPFTSAIYAKRERERAAMGGAAK
KQI*
Coding >Ophun1|3107
ATGGCTCCAAGCAAATCGGCATTCGACTCAAAAGTCATCCTCCAAACAGGCTCCCCTCGTGGACGGGACTTATCT
ATCAAGCTATCTAGACCGTCCCAAACGTCCTCCGAGGCTTGGTTCAACAAGACCCAACCACTTCTCGATGTGCTC
TCCCCTACACCACAAGAGACCGACGATGACTACCGCCGCGTCAAGATTGCCGTCATAGACACAGGCATCTCGCCC
GACCACCCACTGATCAACGACTTCATCGTCAAGAACTTTGTCGAGACCCCAAACGGGAGAGTACGAGACGATCCC
AAGCACGGGACCGACTCGATAGACCTGATCCTCACCATGCTTGACACGGCCAAGATATACGTAGCCAGGGTGTTT
CAAGCCAAGGAAGGGGATCAACTGACACCAGGATATATGGCCGAGGTAAGTCGTCTCCCCTCGGGCAGTCTTCTC
TACGTCGACATCATCAGCATCTCAGCAGGCTTTGAGCACAGCCACGCCAAGCTAGCCGAGGCCATCAGACGAGCT
TCAGCAGCCGACCCCGAGATTCTCATCTTCGCCGCAGCGGCCAACTGGGCCAACACCCAATCCGTTGCCTACCCA
GCTCGGCTAACCGGCCAAGTCTTCTGCATGTTCTCCACCAACGGAGCCCTGAGAAACTCCAGGGACTTCAACCCC
AACGCCCTGGACAACGCCGACAACTTCGCCCTCCTCGGCCAGGACGTGAAGCTGAACCCGCTGAGCCGAGAGGGC
TTATCTGGGACCTCGATCGCTACGGCCGTGGCAGCTGGTCTCGCCGGGAGGATCATCGACTTTACCAGGCATGCG
GACTCTCGGGGGCATCTGACGCAGCAGCATAGAAACAAGGTCGCTTCGAAACTGGGCTTGAGGGAGATTTTCCAC
TTCATGTCTCAAGACCACAAGGACTTGGAGTACCGATGTGTGGCACCGTGGGAACTGCTGCCCCCGGAAGAGATG
TCAGCTCCGACGCAACATCGCGAGGATACAAGATCCAAGATATGCGGAACCATCGAAAGAGCATTATGGAAGCTG
AACATCGTCGCCCGCCAAGAATACCACAAGAAGCTGCTAACCAAGCTCTTCGGCGGCAACTCCCGTCACGCCTGC
TACGCCCTCGCCGCCACCATCTTCTCCCTCGGCCTGGTCCGCGACTGGCTCTACAAGCAGGCCATCCAAGAGCAG
CCCTCTCACGCGCTGCTGCTAACGCCGGCCTCGCGCCTCGCCGGCATCTCCCTCCTCGTCGCCGGAAACGTCCTC
GTCCTGTCGTCGACGTGGGCGCTCGGCATCACGGGCACCTTCTTGGGCGACTACTTCGGTATCCTGATGGACGAC
ATGGTGACGGGCTTTCCCTTTAACGTCTGCGGCGCTCCCATGTACTGGGGCTCTACCATGAGTTTCCTCGGCACC
GCCCTGCTGCTGGGAAAGCCTGCTGGTGTCTTCATCACGGCTTGGGTCTACATCGTGTACTGCGCCGCCCTGCGC
TACGAGGACCCCTTCACCTCGGCCATTTACGCCAAGCGCGAACGAGAGAGGGCTGCCATGGGCGGTGCCGCCAAG
AAGCAGATCTGA
Transcript >Ophun1|3107
ATGGCTCCAAGCAAATCGGCATTCGACTCAAAAGTCATCCTCCAAACAGGCTCCCCTCGTGGACGGGACTTATCT
ATCAAGCTATCTAGACCGTCCCAAACGTCCTCCGAGGCTTGGTTCAACAAGACCCAACCACTTCTCGATGTGCTC
TCCCCTACACCACAAGAGACCGACGATGACTACCGCCGCGTCAAGATTGCCGTCATAGACACAGGCATCTCGCCC
GACCACCCACTGATCAACGACTTCATCGTCAAGAACTTTGTCGAGACCCCAAACGGGAGAGTACGAGACGATCCC
AAGCACGGGACCGACTCGATAGACCTGATCCTCACCATGCTTGACACGGCCAAGATATACGTAGCCAGGGTGTTT
CAAGCCAAGGAAGGGGATCAACTGACACCAGGATATATGGCCGAGGTAAGTCGTCTCCCCTCGGGCAGTCTTCTC
TACGTCGACATCATCAGCATCTCAGCAGGCTTTGAGCACAGCCACGCCAAGCTAGCCGAGGCCATCAGACGAGCT
TCAGCAGCCGACCCCGAGATTCTCATCTTCGCCGCAGCGGCCAACTGGGCCAACACCCAATCCGTTGCCTACCCA
GCTCGGCTAACCGGCCAAGTCTTCTGCATGTTCTCCACCAACGGAGCCCTGAGAAACTCCAGGGACTTCAACCCC
AACGCCCTGGACAACGCCGACAACTTCGCCCTCCTCGGCCAGGACGTGAAGCTGAACCCGCTGAGCCGAGAGGGC
TTATCTGGGACCTCGATCGCTACGGCCGTGGCAGCTGGTCTCGCCGGGAGGATCATCGACTTTACCAGGCATGCG
GACTCTCGGGGGCATCTGACGCAGCAGCATAGAAACAAGGTCGCTTCGAAACTGGGCTTGAGGGAGATTTTCCAC
TTCATGTCTCAAGACCACAAGGACTTGGAGTACCGATGTGTGGCACCGTGGGAACTGCTGCCCCCGGAAGAGATG
TCAGCTCCGACGCAACATCGCGAGGATACAAGATCCAAGATATGCGGAACCATCGAAAGAGCATTATGGAAGCTG
AACATCGTCGCCCGCCAAGAATACCACAAGAAGCTGCTAACCAAGCTCTTCGGCGGCAACTCCCGTCACGCCTGC
TACGCCCTCGCCGCCACCATCTTCTCCCTCGGCCTGGTCCGCGACTGGCTCTACAAGCAGGCCATCCAAGAGCAG
CCCTCTCACGCGCTGCTGCTAACGCCGGCCTCGCGCCTCGCCGGCATCTCCCTCCTCGTCGCCGGAAACGTCCTC
GTCCTGTCGTCGACGTGGGCGCTCGGCATCACGGGCACCTTCTTGGGCGACTACTTCGGTATCCTGATGGACGAC
ATGGTGACGGGCTTTCCCTTTAACGTCTGCGGCGCTCCCATGTACTGGGGCTCTACCATGAGTTTCCTCGGCACC
GCCCTGCTGCTGGGAAAGCCTGCTGGTGTCTTCATCACGGCTTGGGTCTACATCGTGTACTGCGCCGCCCTGCGC
TACGAGGACCCCTTCACCTCGGCCATTTACGCCAAGCGCGAACGAGAGAGGGCTGCCATGGGCGGTGCCGCCAAG
AAGCAGATCTGA
Gene >Ophun1|3107
ATGGCTCCAAGCAAATCGGCATTCGACTCAAAAGTCATCCTCCAAACAGGCTCCCCTCGTGGACGGGACTTATCT
ATCAAGGTATGCTGTGAATGCGCTTCTTTTGACACCAACGGCCGTACACCTATTGAAAGCTATCTAGACCGTCCC
AAACGTCCTCCGAGGCTTGGTTCAACAAGACCCAACCACTTCTCGATGTGCTCTCCCCTACACCACAAGAGACCG
ACGATGACTACCGCCGCGTCAAGATTGCCGTCATAGACACAGGCATCTCGCCCGACCACCCACTGATCAACGACT
TCATCGTCAAGAACTTTGTCGAGACCCCAAACGGGAGAGTACGAGACGATCCCAAGCACGGGACCGACTCGATAG
ACCTGATCCTCACCATGCTTGACACGGCCAAGATATACGTAGCCAGGGTGTTTCAAGCCAAGGAAGGGGATCAAC
TGACACCAGGATATATGGCCGAGGTAAGTCGTCTCCCCTCGGGCAGTCTTCTCTGTACGCCGCCGCTGCTAACAT
CCACTACCGGCCATCGACTGGTCCATCCGACAAGACGTCGACATCATCAGCATCTCAGCAGGCTTTGAGCACAGC
CACGCCAAGCTAGCCGAGGCCATCAGACGAGCTTCAGCAGCCGACCCCGAGATTCTCATCTTCGCCGCAGCGGCC
AACTGGGCCAACACCCAATCCGTTGCCTACCCAGCTCGGCTAACCGGCCAAGTCTTCTGCATGTTCTCCACCAAC
GGAGCCCTGAGAAACTCCAGGGACTTCAACCCCAACGCCCTGGACAACGCCGACAACTTCGCCCTCCTCGGCCAG
GACGTGAAGCTGAACCCGCTGAGCCGAGAGGGCTTATCTGGGACCTCGATCGCTACGGCCGTGGCAGCTGGTCTC
GCCGGGAGGATCATCGACTTTACCAGGCATGCGGACTCTCGGGGGCATCTGACGCAGCAGCATAGAAACAAGGTC
GCTTCGAAACTGGGCTTGAGGGAGATTTTCCACTTCATGTCTCAAGACCACAAGGACTTGGAGTACCGATGTGTG
GCACCGTGGGAACTGCTGCCCCCGGAAGAGATGTCAGCTCCGACGCAACATCGCGAGGATACAAGATCCAAGATA
TGCGGAACCATCGAAAGAGCATTATGGAAGCTGAAGTGATGATGTCGAGGCTTTGATGGAAGAGCCCTGTCTCTG
GAATGTAGCTGTTAGCTAGCAGGGTAGACCTAGGAGCAGGCGGATAAATCCCGGCTTTTCCCGACCCGATCCAGA
GCCGCGCAAAGCCGGACTCGCATGAAATCAGAATCAACGACTCCTCTTTGACCGTGACGGAACACAACGACACTT
GATCTTATTCATCTACCAACTCGCTGGTAAAATGGCACCTCTCATCGACTTTGACAAGCAGAGCTTGCTGGGTGG
GCCTACCTCTATCCATCCATTCCCGATTCCCATCCCAGTCTGATCGTCAACTCGTCCTCATCAGTCTCCCTCTGC
TCCATCACCTTCAACCCGCTGTTCTGGAAGTAAGCAGACTCTCACGCCTCAACCCTCACCAACAGCTAACAAACC
ACTCACCTTCACCCCCCCCCCCCCCCCCCCCCCCAAACAGCATCGTCGCCCGCCAAGGTCCGTCCCGACTCGCAA
GCCAGCCGCACAAGCGCAACAGCTGAACCGTCCAGCAACAGAATACCACAAGAAGCTGCTAACCAAGCTCTTCGG
CGGCAACTCCCGTCACGCCTGCTACGCCCTCGCCGCCACCATCTTCTCCCTCGGCCTGGTCCGCGACTGGCTCTA
CAAGCAGGCCATCCAAGAGCAGCCCTCTCACGCGCTGCTGCTAACGCCGGCCTCGCGCCTCGCCGGCATCTCCCT
CCTCGTCGCCGGAAACGTCCTCGTCCTGTCGTCGACGTGGGCGCTCGGCATCACGGGCACCTTCTTGGGCGACTA
CTTCGGTATCCTGATGGACGACATGGTGACGGGCTTTCCCTTTAACGTCTGCGGCGCTCCCATGTACTGGGGCTC
TACCATGAGTTTCCTCGGCACCGCCCTGCTGCTGGGAAAGCCTGCTGGTGTCTTCATCACGGCTTGGGTCTACAT
CGTGTACTGCGCCGCCCTGCGCTACGAGGACCCCTTCACCTCGGCCATTTACGCCAAGCGCGAACGAGAGAGGGC
TGCCATGGGCGGTGCCGCCAAGAAGCAGATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail