Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3106
Gene name
LocationContig_277:58..4955
Strand-
Gene length (bp)4897
Transcript length (bp)3468
Coding sequence length (bp)3468
Protein length (aa) 1156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00790 VHS VHS domain 8.3E-21 757 891
PF00069 Pkinase Protein kinase domain 6.8E-19 380 661

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87308|LSB5_SCHPO Protein lsb5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsb5 PE=3 SV=1 751 1049 1.0E-38
sp|P25369|LSB5_YEAST LAS seventeen-binding protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB5 PE=1 SV=3 752 1063 1.0E-18
sp|Q5SRX1|TM1L2_MOUSE TOM1-like protein 2 OS=Mus musculus GN=Tom1l2 PE=1 SV=1 752 1052 2.0E-09
sp|Q68FJ8|TM1L2_XENLA TOM1-like protein 2 OS=Xenopus laevis GN=tom1l2 PE=2 SV=1 752 1052 4.0E-09
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 384 567 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87308|LSB5_SCHPO Protein lsb5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsb5 PE=3 SV=1 751 1049 1.0E-38
sp|P25369|LSB5_YEAST LAS seventeen-binding protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LSB5 PE=1 SV=3 752 1063 1.0E-18
sp|Q5SRX1|TM1L2_MOUSE TOM1-like protein 2 OS=Mus musculus GN=Tom1l2 PE=1 SV=1 752 1052 2.0E-09
sp|Q68FJ8|TM1L2_XENLA TOM1-like protein 2 OS=Xenopus laevis GN=tom1l2 PE=2 SV=1 752 1052 4.0E-09
sp|Q9C9U2|CDKD1_ARATH Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1 384 567 5.0E-08
sp|Q6ZVM7|TM1L2_HUMAN TOM1-like protein 2 OS=Homo sapiens GN=TOM1L2 PE=1 SV=1 752 1099 6.0E-08
sp|Q923U0|TM1L1_MOUSE TOM1-like protein 1 OS=Mus musculus GN=Tom1l1 PE=1 SV=1 753 1103 8.0E-07
sp|Q92241|PHO85_KLULA Negative regulator of the PHO system OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PHO85 PE=3 SV=2 380 658 2.0E-06
sp|O88746|TOM1_MOUSE Target of Myb protein 1 OS=Mus musculus GN=Tom1 PE=1 SV=1 752 1099 3.0E-06
sp|Q4V793|HIPK4_RAT Homeodomain-interacting protein kinase 4 OS=Rattus norvegicus GN=Hipk4 PE=2 SV=1 397 578 5.0E-06
sp|Q3V016|HIPK4_MOUSE Homeodomain-interacting protein kinase 4 OS=Mus musculus GN=Hipk4 PE=1 SV=2 397 578 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035091 phosphatidylinositol binding Yes
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0043130 ubiquitin binding Yes
GO:0019538 protein metabolic process No
GO:0044237 cellular metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0005543 phospholipid binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008289 lipid binding No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032182 ubiquitin-like protein binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0005515 protein binding No
GO:0006793 phosphorus metabolic process No
GO:0016310 phosphorylation No
GO:0036211 protein modification process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0035639 purine ribonucleoside triphosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3106
MPHPGQETAHDANDIHLERLLKLTDHVADVFTQILSHQRDLPYRVLDSLDKQAARFKCWRIVAGLSTSSHHGQAL
AVARLDDAPAMRGALIAALEYLCLQLGAGERQKFGRWPAEDTETCSSNSRDRVLSMDAINRVESTITTLHQLSIS
NRRTALLTSTDLLVQLYQSDNEDPVAELSIRLLSKRVWSAFSASYFIPDDALHTVIDVASTERVLAAASPERHST
KTAACARTVCQDADSAGLRRVFAVLVLLRSISALDAFIHLSLTDGRLPLLPNDAVWIELIEAVDGDTVHRFAELQ
WLVLAPRLIRHHDTETYCLDRSAIVPCLEAQVIPKFGGDPDSTQPGHEHRQPIILQCSPVWKVKIHAGHIAASHK
RDTPYFAFKQQQGLSEREALGEIANLRELRYLGRPQEHIIELLDSFFYKDDFYLVFDWAEDNLMQYWQRNGEPKL
TKGLLRWASSQISGLTQGLAAIHDELMGFHGDITSHNVLRFTGTDTSSPYGTLKLSDFGLAQFPGRCHQSGSSSE
RFYDLHCDPTYQSPECQPPESPNDMPMNVTQKSDIWPLGCVYLNFVTWLVCGWTGLEQFSHQRLDEHESDMQVDS
FFKIEDETRPRPVLKTSVSRRMDQFKSIESQPMFTHDLVDVIRDNMLQVNPRKRLSSRALCDWLLELHDKCQNTQ
RGPEDDEATLVSSPRVTQAIKVRYVRRSSLKLFLNELFPECPVKMSHIDDMWIVTLPRKLTEPSCFCNDIARPPS
MFSQKKPYSAITVTIENLTSESYSVDSFSGIPDLVEVIKLQATGPTEAARAIRKKLKYGNVHRQLRALVILDGLI
QNAGSNFQRTFADEPLLERLRVCGTSGLSDAAVRNKATELFREWSQYANTPGLERVARLYRELPKRKVTVTQDKS
KVIRETENPFGDDDEPEPDRGSRAGPEPTSSARSSQHADQDKKKKKKDIKPRFGSSRRSFSLEAEKESIKSVIAE
ASIESTNLMNSLQSINRERQRISENRGAVQHFDACKQLRRRILRYIHLVDSEQWLGSLLHANDELVHALMSFEQL
DRSIDADSDSDDELAEQAHLYRMNTGTHRSTANPATSSARTLELAGLTLNPSPKPAPPPVPRAPQPAHGPRVDQL
KMPKQEEDDDPFSDNNVVGTPPLEREEPRW*
Coding >Ophun1|3106
ATGCCTCATCCCGGACAAGAAACAGCTCACGATGCCAACGACATCCACCTCGAGCGCCTCCTAAAGCTGACCGAC
CACGTGGCCGACGTGTTTACCCAGATTCTGAGCCATCAGAGAGACCTGCCATACCGTGTCTTGGATTCCCTCGAC
AAGCAAGCTGCCAGGTTCAAGTGCTGGAGGATCGTCGCCGGCCTCTCGACATCTTCCCACCATGGCCAGGCTCTC
GCCGTGGCTCGCCTTGATGATGCTCCCGCCATGAGGGGCGCCCTAATTGCTGCTCTAGAGTACCTGTGTCTTCAG
TTGGGTGCCGGTGAGCGTCAGAAGTTCGGACGCTGGCCCGCAGAAGACACCGAGACATGCTCTAGCAACAGCAGA
GATCGAGTCTTGTCCATGGACGCCATAAACCGAGTCGAGTCGACCATTACAACGCTCCATCAACTTTCTATTTCC
AACAGGCGGACTGCTCTTCTGACCTCCACCGACCTCCTCGTTCAGTTATATCAGTCGGACAATGAAGACCCCGTG
GCTGAGCTGTCCATCAGGTTGCTGTCCAAGCGAGTCTGGTCGGCCTTTAGTGCCAGCTACTTCATCCCAGACGAT
GCCCTGCACACCGTCATAGACGTGGCCAGCACGGAAAGGGTCCTAGCTGCGGCGTCTCCGGAGCGCCATAGCACC
AAGACAGCAGCTTGTGCGAGGACTGTTTGTCAAGATGCCGACTCCGCCGGACTGCGCCGAGTCTTTGCGGTTCTG
GTACTGCTACGCAGCATCAGCGCTCTCGACGCCTTTATCCACCTCTCGCTGACTGACGGTCGTCTACCACTGCTA
CCAAACGATGCCGTATGGATAGAGTTGATAGAAGCTGTTGATGGTGATACGGTTCATCGATTCGCCGAACTCCAA
TGGCTGGTTCTTGCACCACGACTCATCAGGCATCATGACACCGAAACCTACTGCTTGGATCGCTCAGCTATAGTT
CCTTGCCTGGAGGCTCAGGTTATACCGAAGTTTGGTGGGGATCCAGACTCAACGCAGCCAGGCCACGAACATAGA
CAGCCCATCATCCTTCAGTGCAGTCCCGTGTGGAAGGTCAAGATTCATGCTGGCCACATAGCAGCGTCCCATAAG
AGGGATACCCCGTACTTTGCCTTCAAGCAACAACAAGGCTTGTCGGAACGGGAGGCCTTGGGGGAGATTGCCAAC
CTGAGAGAACTGCGATATCTCGGTCGTCCGCAAGAGCACATCATCGAGCTGCTAGACTCCTTCTTCTACAAGGAT
GACTTCTATCTAGTGTTTGACTGGGCAGAAGACAACCTGATGCAGTATTGGCAGCGAAATGGTGAGCCCAAGTTG
ACCAAGGGGTTGCTGAGATGGGCCAGCTCGCAGATATCTGGACTTACTCAGGGCCTTGCGGCGATTCACGACGAG
CTGATGGGCTTCCACGGAGACATCACGTCACACAACGTCCTCAGATTCACCGGAACAGACACCTCAAGTCCCTAC
GGCACCCTCAAACTGTCAGACTTTGGACTGGCACAGTTCCCTGGACGTTGCCACCAATCGGGCTCCTCCAGCGAG
CGATTCTACGATCTGCATTGCGACCCGACCTACCAGTCTCCGGAGTGTCAACCGCCGGAGAGCCCGAACGATATG
CCCATGAACGTCACTCAGAAGTCCGACATCTGGCCCCTTGGCTGCGTCTACCTCAACTTCGTGACGTGGCTGGTC
TGTGGCTGGACTGGGTTGGAGCAGTTTTCCCATCAACGACTGGACGAGCATGAATCGGACATGCAAGTCGACTCT
TTCTTCAAAATCGAGGATGAAACACGCCCGCGCCCCGTTCTGAAAACCTCGGTCAGCCGGAGAATGGATCAGTTC
AAGAGTATCGAGTCCCAGCCAATGTTTACCCATGATCTGGTCGACGTCATACGGGACAATATGCTCCAGGTGAAC
CCACGGAAACGCCTCTCTTCTCGAGCCTTATGTGATTGGCTTCTGGAGTTGCATGACAAGTGCCAGAATACGCAG
CGAGGCCCGGAAGATGATGAAGCGACGCTGGTCTCCTCCCCGCGGGTCACGCAGGCTATTAAAGTGAGATATGTC
AGGCGAAGTTCGCTGAAATTGTTTCTCAACGAGTTGTTTCCCGAATGCCCCGTCAAGATGAGCCACATTGACGAC
ATGTGGATAGTTACCCTGCCGAGGAAACTCACCGAGCCCTCGTGCTTCTGCAACGACATCGCACGGCCGCCCAGC
ATGTTCTCTCAGAAGAAACCGTACTCGGCCATTACCGTCACCATCGAGAATCTCACCAGCGAATCCTACAGCGTC
GACAGCTTCAGCGGCATCCCTGACCTGGTCGAGGTCATCAAGCTCCAGGCCACGGGCCCTACAGAGGCGGCGCGG
GCCATCCGCAAGAAGCTCAAGTACGGCAATGTCCACCGCCAGCTCCGCGCCCTCGTCATTCTCGACGGGCTCATC
CAGAATGCCGGATCCAACTTCCAGCGCACCTTTGCCGACGAGCCCCTGCTCGAGCGGCTCAGGGTGTGCGGCACT
TCGGGCCTTTCCGACGCAGCCGTCAGGAACAAGGCCACGGAGCTTTTCCGGGAGTGGTCGCAATACGCCAACACT
CCCGGGCTGGAGCGCGTCGCCCGGCTTTACAGGGAACTTCCCAAGAGAAAGGTGACGGTCACGCAAGATAAATCA
AAGGTCATACGCGAGACCGAGAACCCGTTTGGAGACGACGATGAACCCGAGCCAGACCGTGGTTCACGAGCTGGG
CCGGAACCGACCTCGTCAGCCAGGTCCAGCCAACACGCCGACCAGGACAAGAAGAAGAAGAAAAAGGACATCAAG
CCCAGGTTTGGGAGCAGCCGCAGATCGTTTAGCCTCGAGGCGGAAAAGGAGTCGATCAAGTCCGTAATCGCCGAA
GCGTCCATCGAGTCGACCAACCTGATGAACTCGCTCCAGAGCATCAACCGCGAGCGCCAGCGCATTTCGGAGAAC
CGGGGGGCTGTGCAGCACTTTGACGCGTGCAAGCAGCTCCGGCGAAGGATCCTCCGCTACATCCACCTGGTTGAC
AGCGAGCAATGGCTCGGCAGCCTGCTTCACGCCAACGACGAGCTCGTGCATGCCCTCATGTCGTTTGAGCAGCTG
GACCGGTCCATCGATGCCGATAGCGACTCGGACGACGAGCTGGCCGAGCAAGCTCACCTCTATCGAATGAACACG
GGCACGCACAGGAGCACAGCCAACCCGGCGACATCGAGTGCCCGCACCCTGGAACTGGCCGGTCTCACCCTCAAC
CCTTCTCCCAAGCCGGCCCCGCCTCCAGTTCCTCGGGCGCCACAGCCGGCTCATGGGCCGCGCGTTGATCAGCTC
AAGATGCCCAAGCAGGAAGAGGACGACGACCCTTTCAGCGACAACAACGTGGTAGGGACGCCACCGCTCGAGCGA
GAGGAGCCCCGCTGGTAG
Transcript >Ophun1|3106
ATGCCTCATCCCGGACAAGAAACAGCTCACGATGCCAACGACATCCACCTCGAGCGCCTCCTAAAGCTGACCGAC
CACGTGGCCGACGTGTTTACCCAGATTCTGAGCCATCAGAGAGACCTGCCATACCGTGTCTTGGATTCCCTCGAC
AAGCAAGCTGCCAGGTTCAAGTGCTGGAGGATCGTCGCCGGCCTCTCGACATCTTCCCACCATGGCCAGGCTCTC
GCCGTGGCTCGCCTTGATGATGCTCCCGCCATGAGGGGCGCCCTAATTGCTGCTCTAGAGTACCTGTGTCTTCAG
TTGGGTGCCGGTGAGCGTCAGAAGTTCGGACGCTGGCCCGCAGAAGACACCGAGACATGCTCTAGCAACAGCAGA
GATCGAGTCTTGTCCATGGACGCCATAAACCGAGTCGAGTCGACCATTACAACGCTCCATCAACTTTCTATTTCC
AACAGGCGGACTGCTCTTCTGACCTCCACCGACCTCCTCGTTCAGTTATATCAGTCGGACAATGAAGACCCCGTG
GCTGAGCTGTCCATCAGGTTGCTGTCCAAGCGAGTCTGGTCGGCCTTTAGTGCCAGCTACTTCATCCCAGACGAT
GCCCTGCACACCGTCATAGACGTGGCCAGCACGGAAAGGGTCCTAGCTGCGGCGTCTCCGGAGCGCCATAGCACC
AAGACAGCAGCTTGTGCGAGGACTGTTTGTCAAGATGCCGACTCCGCCGGACTGCGCCGAGTCTTTGCGGTTCTG
GTACTGCTACGCAGCATCAGCGCTCTCGACGCCTTTATCCACCTCTCGCTGACTGACGGTCGTCTACCACTGCTA
CCAAACGATGCCGTATGGATAGAGTTGATAGAAGCTGTTGATGGTGATACGGTTCATCGATTCGCCGAACTCCAA
TGGCTGGTTCTTGCACCACGACTCATCAGGCATCATGACACCGAAACCTACTGCTTGGATCGCTCAGCTATAGTT
CCTTGCCTGGAGGCTCAGGTTATACCGAAGTTTGGTGGGGATCCAGACTCAACGCAGCCAGGCCACGAACATAGA
CAGCCCATCATCCTTCAGTGCAGTCCCGTGTGGAAGGTCAAGATTCATGCTGGCCACATAGCAGCGTCCCATAAG
AGGGATACCCCGTACTTTGCCTTCAAGCAACAACAAGGCTTGTCGGAACGGGAGGCCTTGGGGGAGATTGCCAAC
CTGAGAGAACTGCGATATCTCGGTCGTCCGCAAGAGCACATCATCGAGCTGCTAGACTCCTTCTTCTACAAGGAT
GACTTCTATCTAGTGTTTGACTGGGCAGAAGACAACCTGATGCAGTATTGGCAGCGAAATGGTGAGCCCAAGTTG
ACCAAGGGGTTGCTGAGATGGGCCAGCTCGCAGATATCTGGACTTACTCAGGGCCTTGCGGCGATTCACGACGAG
CTGATGGGCTTCCACGGAGACATCACGTCACACAACGTCCTCAGATTCACCGGAACAGACACCTCAAGTCCCTAC
GGCACCCTCAAACTGTCAGACTTTGGACTGGCACAGTTCCCTGGACGTTGCCACCAATCGGGCTCCTCCAGCGAG
CGATTCTACGATCTGCATTGCGACCCGACCTACCAGTCTCCGGAGTGTCAACCGCCGGAGAGCCCGAACGATATG
CCCATGAACGTCACTCAGAAGTCCGACATCTGGCCCCTTGGCTGCGTCTACCTCAACTTCGTGACGTGGCTGGTC
TGTGGCTGGACTGGGTTGGAGCAGTTTTCCCATCAACGACTGGACGAGCATGAATCGGACATGCAAGTCGACTCT
TTCTTCAAAATCGAGGATGAAACACGCCCGCGCCCCGTTCTGAAAACCTCGGTCAGCCGGAGAATGGATCAGTTC
AAGAGTATCGAGTCCCAGCCAATGTTTACCCATGATCTGGTCGACGTCATACGGGACAATATGCTCCAGGTGAAC
CCACGGAAACGCCTCTCTTCTCGAGCCTTATGTGATTGGCTTCTGGAGTTGCATGACAAGTGCCAGAATACGCAG
CGAGGCCCGGAAGATGATGAAGCGACGCTGGTCTCCTCCCCGCGGGTCACGCAGGCTATTAAAGTGAGATATGTC
AGGCGAAGTTCGCTGAAATTGTTTCTCAACGAGTTGTTTCCCGAATGCCCCGTCAAGATGAGCCACATTGACGAC
ATGTGGATAGTTACCCTGCCGAGGAAACTCACCGAGCCCTCGTGCTTCTGCAACGACATCGCACGGCCGCCCAGC
ATGTTCTCTCAGAAGAAACCGTACTCGGCCATTACCGTCACCATCGAGAATCTCACCAGCGAATCCTACAGCGTC
GACAGCTTCAGCGGCATCCCTGACCTGGTCGAGGTCATCAAGCTCCAGGCCACGGGCCCTACAGAGGCGGCGCGG
GCCATCCGCAAGAAGCTCAAGTACGGCAATGTCCACCGCCAGCTCCGCGCCCTCGTCATTCTCGACGGGCTCATC
CAGAATGCCGGATCCAACTTCCAGCGCACCTTTGCCGACGAGCCCCTGCTCGAGCGGCTCAGGGTGTGCGGCACT
TCGGGCCTTTCCGACGCAGCCGTCAGGAACAAGGCCACGGAGCTTTTCCGGGAGTGGTCGCAATACGCCAACACT
CCCGGGCTGGAGCGCGTCGCCCGGCTTTACAGGGAACTTCCCAAGAGAAAGGTGACGGTCACGCAAGATAAATCA
AAGGTCATACGCGAGACCGAGAACCCGTTTGGAGACGACGATGAACCCGAGCCAGACCGTGGTTCACGAGCTGGG
CCGGAACCGACCTCGTCAGCCAGGTCCAGCCAACACGCCGACCAGGACAAGAAGAAGAAGAAAAAGGACATCAAG
CCCAGGTTTGGGAGCAGCCGCAGATCGTTTAGCCTCGAGGCGGAAAAGGAGTCGATCAAGTCCGTAATCGCCGAA
GCGTCCATCGAGTCGACCAACCTGATGAACTCGCTCCAGAGCATCAACCGCGAGCGCCAGCGCATTTCGGAGAAC
CGGGGGGCTGTGCAGCACTTTGACGCGTGCAAGCAGCTCCGGCGAAGGATCCTCCGCTACATCCACCTGGTTGAC
AGCGAGCAATGGCTCGGCAGCCTGCTTCACGCCAACGACGAGCTCGTGCATGCCCTCATGTCGTTTGAGCAGCTG
GACCGGTCCATCGATGCCGATAGCGACTCGGACGACGAGCTGGCCGAGCAAGCTCACCTCTATCGAATGAACACG
GGCACGCACAGGAGCACAGCCAACCCGGCGACATCGAGTGCCCGCACCCTGGAACTGGCCGGTCTCACCCTCAAC
CCTTCTCCCAAGCCGGCCCCGCCTCCAGTTCCTCGGGCGCCACAGCCGGCTCATGGGCCGCGCGTTGATCAGCTC
AAGATGCCCAAGCAGGAAGAGGACGACGACCCTTTCAGCGACAACAACGTGGTAGGGACGCCACCGCTCGAGCGA
GAGGAGCCCCGCTGGTAG
Gene >Ophun1|3106
ATGCCTCATCCCGGACAAGAAACAGCTCACGATGCCAACGACATCCACCTCGAGCGCCTCCTAAAGCTGACCGAC
CACGTGGCCGACGTGTTTACCCAGATTCTGAGCCATCAGAGAGACCTGCCATACCGTGTCTTGGATTCCCTCGAC
AAGCAAGCTGCCAGGTTCAAGTGCTGGAGGATCGTCGCCGGCCTCTCGACATCTTCCCACCATGGCCAGGCTCTC
GCCGTGGCTCGCCTTGATGATGCTCCCGCCATGAGGGGCGCCCTAATTGCTGCTCTAGAGTACCTGTGTCTTCAG
TTGGGTGCCGGTGAGCGTCAGAAGTTCGGACGCTGGCCCGCAGAAGACACCGAGACATGCTCTAGCAACAGCAGA
GATCGAGTCTTGTCCATGGACGCCATAAACCGAGTCGAGTCGACCATTACAACGCTCCATCAACTTTCTATTTCC
AACAGGCGGACTGCTCTTCTGACCTCCACCGACCTCCTCGTTCAGTTATATCAGTCGGACAATGAAGACCCCGTG
GCTGAGCTGTCCATCAGGTTGCTGTCCAAGCGAGTCTGGTCGGCCTTTAGTGCCAGCTACTTCATCCCAGACGAT
GCCCTGCACACCGTCATAGACGTGGCCAGCACGGAAAGGGTCCTAGCTGCGGCGTCTCCGGAGCGCCATAGCACC
AAGACAGCAGCTTGTGCGAGGACTGTTTGTCAAGATGCCGACTCCGCCGGACTGCGCCGAGTCTTTGCGGTTCTG
GTACTGCTACGCAGCATCAGCGCTCTCGACGCCTTTATCCACCTCTCGCTGACTGACGGTCGTCTACCACTGCTA
CCAAACGATGCCGTATGGATAGAGTTGATAGAAGCTGTTGATGGTGATACGGTTCATCGATTCGCCGAACTCCAA
TGGCTGGTTCTTGCACCACGACTCATCAGGCATCATGACACCGAAACCTACTGCTTGGATCGCTCAGCTATAGTT
CCTTGCCTGGAGGCTCAGGTTATACCGAAGTTTGGTGGGGATCCAGACTCAACGCAGCCAGGCCACGAACATAGA
CAGCCCATCATCCTTCAGTGCAGTCCCGTGTGGAAGGTCAAGATTCATGCTGGCCACATAGCAGCGTCCCATAAG
AGGGTTCGTGCCACCTTGAGGATGAAGGAAGTGAATTTGCTAAAGTCAGGCAGGATACCCCGTACTTTGCCTTCA
AGCAACAACAAGGCTTGTCGGAACGGGAGGCCTTGGGGGAGATTGCCAACCTGAGAGAACTGCGATATCTCGGTC
GTCCGCAAGAGCACATCATCGAGCTGCTAGACTCCTTCTTCTACAAGGATGACTTCTATCTAGTGTTTGACTGGG
CAGAAGACAACCTGATGCAGTATTGGCAGCGAAATGGTGAGCCCAAGTTGACCAAGGGGTTGCTGAGATGGGCCA
GCTCGCAGATATCTGGACTTACTCAGGGCCTTGCGGCGATTCACGACGAGCTGATGGGCTTCCACGGAGACATCA
CGTCACACAACGTCCTCAGATTCACCGGAACAGACACCTCAAGTCCCTACGGCACCCTCAAACTGTCAGACTTTG
GACTGGCACAGTTCCCTGGACGTTGCCACCAATCGGGCTCCTCCAGCGAGCGATTCTACGATCTGCATTGCGACC
CGACCTACCAGTCTCCGGAGTGTCAACCGCCGGAGAGCCCGAACGATATGCCCATGAACGTCACTCAGAAGTCCG
ACATCTGGCCCCTTGGCTGCGTCTACCTCAACTTCGTGACGTGGCTGGTCTGTGGCTGGACTGGGTTGGAGCAGT
TTTCCCATCAACGACTGGACGAGCATGAATCGGACATGCAAGTCGACTCTTTCTTCAAAATCGAGGATGAAACAC
GCCCGCGCCCCGTTCTGAAAACCTCGGTCAGCCGGAGAATGGATCAGTTCAAGAGTATCGAGTCCCAGCCAATGT
TTACCCATGATCTGGTCGACGTCATACGGGACAATATGCTCCAGGTGAACCCACGGAAACGCCTCTCTTCTCGAG
CCTTATGTGATTGGCTTCTGGAGTTGCATGACAAGTGCCAGAATACGCAGCGAGGCCCGGAAGATGATGAAGCGA
CGCTGGTCTCCTCCCCGCGGGTCACGCAGGCTATTAAAGTGAGATATGTCAGGCGAAGTTCGCTGAAATTGTTTC
TCAACGAGTTGTTTCCCGAATGCCCCGTCAAGATGAGCCACATTGACGACATGTGGATAGTTACCCTGCCGAGGA
AACTCACCGAGGTAAGTTACACAGCTCGTTTGAAGCCGTTGACGCTGAGGCTTAGAGCAGGCCGACATTGAGCAT
CTACGAGAAGAGTATGCAGATGGGTAGAACTCACCATGGGTCTTGTCTAAGGATGAGTTGCGGTCATGATCTTGA
TGAGTCGAGATCCCGCTAGATACTTTACAAGCAGCCATCTTGCCGTAAACGGTGATTGCGGCTACCAGGAATTAC
ACGTCCTGACGGTGGTGAATGAATCCCTTGAGAGGCTGGATGACGTGGACTTTTGTGAAAGTGACTGGCAATCTG
CACTCGTCTATCGTTGAAAGAGCCGTGCCAAGATGCCGGCTAGTGCAGCTATTTTTGTCGGAAATCACCGTCTAT
GTGTTCGTACACTTGCTGGCGAGAATTGACTGATAAAGGGAGAGGCGATCAAGGATCCATAGCGAGGCCGATGTC
GTGACGATGGGATCTTGTCTTTGCACGTGACTGACGTGCCCAATTCAATTCGACTCCACGCTACCCTAGAGTCGG
ACGGGTGCGGAAACCATCGAGATGGCGTCAGACATGGATTGCGTTTCACGTGGTGCAGGGGCATTGATTGTGGGC
AGGCTTCTCGAACTTCTCGTATTGTGATTCGGTTACACAGCCGTCATTGTTTCTCTTTGTCATTGATCATTGTTG
TCGTTTCCGTAGATGCATCATGTGTCTTGTTCCCGGAAGACGCGAACGAAGCCGCTCTCCGACGCGAGCGAGGGT
CTGCCATTCCTACCTACGGGGCGCAGCCTGATGGATGATTCCAGCTTTGTAGAGGTGACGTGAGGCGCTGTTTGG
TGTTTGGCCTGCCTGCCTGCCCCTCCTGTATTTTCGTAGGTGCACACGTAACGGGTCGCACCACAGACGCGCCTC
GGGCCGTCTTGATTCCTTTCTGCTTCCCTAGTTCTGCTCCTCCTCATCCTCCTCCTCATCCTCATTCTCCTCATC
CTCATTCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCTACCTACCTTCATCATCCCACCAGCTCAGCCTC
GCTCGAGCCTCCTCCGCACGCCGCTCCGTCCGCCTCGTTCCCGCCCGGACCAGACCGACGTTACCGTCCGGGGCA
GCTTGGAGCCTGAGCCTGAGCCTTGGGCCGACGGGAGCTCTGACGTCCAAGATAGCCCTCGTGCTTCTGCAACGA
CATCGCACGGCCGCCCAGCATGTTCTCTCAGGTACGCAGACTCTTCTCGTCGCCCTGCATCCGGTCTCACTCCTC
TTGCTAGAAGAAACCGTACTCGGCCATTACCGTCACCATCGAGAATCTCACCAGCGAATCCTACAGCGTCGACAG
CTTCAGCGGCATCCCTGACCTGGTCGAGGTCATCAAGCTCCAGGCCACGGGCCCTACAGAGGCGGCGCGGGCCAT
CCGCAAGAAGCTCAAGTACGGCAATGTCCACCGCCAGCTCCGCGCCCTCGTCATTCTCGACGGGCTCATCCAGAA
TGCCGGATCCAACTTCCAGCGCACCTTTGCCGACGAGCCCCTGCTCGAGCGGCTCAGGGTGTGCGGCACTTCGGG
CCTTTCCGACGCAGCCGTCAGGAACAAGGCCACGGAGCTTTTCCGGGAGTGGTCGCAATACGCCAACACTCCCGG
GCTGGAGCGCGTCGCCCGGCTTTACAGGGTGAGCGCCTCTGCGTCTATCTGGGTGACGTCTATCTGATGGTGGAG
CTAGGAACTTCCCAAGAGAAAGGTGACGGTCACGCAAGATAAATCAAAGGTCATACGCGAGACCGAGAACCCGTT
TGGAGACGACGATGAACCCGAGCCAGACCGTGGTTCACGAGCTGGGCCGGAACCGACCTCGTCAGCCAGGTCCAG
CCAACACGCCGACCAGGACAAGAAGAAGAAGAAAAAGGACATCAAGCCCAGGTTTGGGAGCAGCCGCAGATCGTT
TAGCCTCGAGGCGGAAAAGGAGTCGATCAAGTCCGTAATCGCCGAAGCGTCCATCGAGTCGACCAACCTGATGAA
CTCGCTCCAGAGCATCAACCGCGAGCGCCAGCGCATTTCGGAGAACCGGGGGGCTGTGCAGCACTTTGACGCGTG
CAAGCAGCTCCGGCGAAGGATCCTCCGCTACGTAAGGCCCCGAATGTTGTTGCTCCGTGCGATTGTTGACTCCGG
ATGGACAGATCCACCTGGTTGACAGCGAGCAATGGCTCGGCAGCCTGCTTCACGCCAACGACGAGCTCGTGCATG
CCCTCATGTCGTTTGAGCAGCTGGACCGGTCCATCGATGCCGATAGCGACTCGGACGACGAGCTGGCCGAGCAAG
CTCACCTCTATCGAAGTAGGCTTCTACGTATCCGGCCCCTCCTGTCATGCTGCTGACACGGGGGATTCTAGTGAA
CACGGGCACGCACAGGAGCACAGCCAACCCGGCGACATCGAGTGCCCGCACCCTGGAACTGGCCGGTCTCACCCT
CAACCCTTCTCCCAAGCCGGCCCCGCCTCCAGTTCCTCGGGCGCCACAGCCGGCTCATGGGCCGCGCGTTGATCA
GCTCAAGATGCCCAAGCAGGAAGAGGACGACGACCCTTTCAGCGACAACAACGTGGTAGGGACGCCACCGCTCGA
GCGAGAGGAGCCCCGCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail