Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3093
Gene name
LocationContig_275:10657..15475
Strand+
Gene length (bp)4818
Transcript length (bp)4665
Coding sequence length (bp)4665
Protein length (aa) 1555

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12816 Vps8 Golgi CORVET complex core vacuolar protein 8 1.1E-69 686 886

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0P5W1|VPS8_MOUSE Vacuolar protein sorting-associated protein 8 homolog OS=Mus musculus GN=Vps8 PE=1 SV=1 131 1428 1.0E-87
sp|Q8N3P4|VPS8_HUMAN Vacuolar protein sorting-associated protein 8 homolog OS=Homo sapiens GN=VPS8 PE=1 SV=3 131 1428 8.0E-82
sp|P39702|VPS8_YEAST Vacuolar protein sorting-associated protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS8 PE=1 SV=2 159 1535 2.0E-80
sp|O13756|VPS8_SCHPO Vacuolar protein sorting-associated protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps8 PE=3 SV=1 658 1019 3.0E-10
sp|O13756|VPS8_SCHPO Vacuolar protein sorting-associated protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps8 PE=3 SV=1 141 310 2.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3814
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|778
Ophiocordyceps australis map64 (Brazil) OphauB2|4399
Ophiocordyceps camponoti-floridani Ophcf2|02265
Ophiocordyceps camponoti-rufipedis Ophun1|3093 (this protein)
Ophiocordyceps kimflemingae Ophio5|5876
Ophiocordyceps subramaniannii Hirsu2|7481

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3093
MSDPQDTSPTRDEGVDEPDADVLQMEPQQDRPVTPEASLRPSAGPRLRSGSLLSSADVSLSLVEGLPRRAGSPVE
SLASGMGNTPVLPSAATRPGLGSPSPSFRPFDRRFHARYSPSPTSTPRGSSPAFVSGHSRNVSFMSNLPLDQADT
DTPSAPWDVVRWTRLKKLNNSAFSELGRRNFGSPTCVAVSTSIVLGTSKGIILMFDYHQNIKMIIGQGTQAVESG
PVTSIAVSADHSTIAGGHANGNIFTWDTSRAARPFLSIPHLHESRVQDRSADGHIPNVSVIHLGFLGTRHTALVS
ADDRGMAFSHLATRGTGALGRTVKTTRILGRYPGAPTPAGKPLKPSTVLAFAPLPLGNVERATDTMGLTAMLTPY
LLVVVSTTPVARTQHKSARPKEVPAHAAMTGCLAWFPAVKLKVPDPASGSDVSKVKLVYCWSNVLTVLDVDETPS
EDPDQPSSLKFKARSRWKCEEAIVAVQWLTRSVLTVLTISQRLIVLEDGTLRMTEAFDLLQKHIYHTDLFSKQLH
NLVEQLDNEDDSMHGVVADAFYMSFKTYKGRIFLLGFSEVSIGALANWADRLIAMMEHGDYVGAIRLATSYYTGD
ADKLTIGLPEDAKLRHSMVQEKIVEIMAASLKYAFGQRLSNSDNADDDQLRRLAEACFAACQAIGTTDYLFDEVY
ERYEAAAVTGVFHETLEPYVLEEAITSVPPAVVKDLVAYHVSRGWEGRLEELICRMQTVTFDLDQITSLCKENSL
YDALIYVWNQALGDYISPMMDLLSLLVPLTTNGQHGAEASEDYYGVNALKIFPYLSYILTSRAYPSGDLMDDGAA
SRAKSEIYWFFFSGKTIEWPRGSGRELLTRPPGEAEPAFPYLRMVLKFDAPSFLSALNEAFEDSFLNDSPDRRVN
GGAGVDLPEEQVFSLAINRQYIVAILVDVMGPDKFAPEDTIYLDMFIARNLPKFPQYLLFSGSTLSRVLSNLCSY
PGEDLAEDAQLSAEYLLSVYHPSDMSALMPLFREAGFYRILKRIYKMEKQYGKLVATYFEDPDDQDAVFDAISDC
LRLPGGTPLNDRRRHEVLRVVEERALDLLELCPRRAAATLALQGAEFHARIVASAEDRPELQFAYLKALLEPDVG
GGRVQQAVAPDRQLVEHHVRLMCRFEPLRVSDYVGAVQFADLRLEELLPTMEATGVVDAAVVLMARDGQAEKALE
RLVKHLFTLESVAQGLLSGVDELDDAPYESVEDVLRGLQRYVYVGIWLCQGQSKTSQQKKAIVVQKKQRDTGQDK
LSADETLWVSLIDACVQVTKRLSPALQALGEEDGVKLVPLLRSLVQHTFTSLLKTTSGQAHEQQGSKLLTNAGAN
LSFLRIMRAFLTQAAASSPDVADLREVLSSIFAAYAYEESILKLSNRLLERSLFVNVKQAVDLRQRGWRPRGSTC
EACGRRVWGPGVAGGAVLDAWEERQSLEEARRRDRKASRARIDGGEGVFEGRDKGKSPDRSAVADAHVTGLEEAS
GTVADGVVREASSGPLVVLACRHIFHLSCLEPLQEGRENGGSGRERGFKCPVDG*
Coding >Ophun1|3093
ATGTCTGACCCACAAGACACGTCTCCGACGCGAGACGAAGGAGTCGATGAGCCGGACGCTGATGTCCTCCAGATG
GAGCCGCAGCAGGACCGTCCGGTGACGCCCGAGGCCAGTCTGCGTCCTTCGGCCGGGCCGCGGCTCCGGAGCGGC
TCCTTGCTGAGCTCGGCGGATGTGAGCCTGAGCTTGGTGGAAGGGCTGCCGAGGAGGGCTGGAAGTCCTGTTGAA
TCGCTGGCTTCTGGCATGGGGAATACGCCCGTCTTGCCCTCGGCAGCGACTCGTCCCGGCCTCGGCAGTCCGTCG
CCTTCGTTTCGGCCTTTTGATCGCCGCTTTCACGCTCGCTACTCGCCCTCGCCGACGAGCACTCCGCGCGGCTCG
TCGCCCGCCTTTGTCTCAGGCCACAGCCGGAACGTGTCGTTCATGTCGAATTTGCCCCTCGACCAGGCTGACACG
GACACGCCTTCTGCGCCCTGGGATGTTGTTCGCTGGACCAGGCTCAAGAAGCTTAACAATAGTGCCTTTTCGGAG
CTGGGCAGGCGTAACTTTGGCTCGCCGACTTGTGTTGCGGTTTCGACTTCCATTGTGCTGGGGACGTCCAAGGGA
ATAATCTTAATGTTTGATTACCACCAGAATATCAAGATGATCATCGGTCAGGGCACGCAAGCCGTCGAGTCCGGC
CCCGTCACGTCCATCGCTGTCTCTGCCGACCACAGCACCATTGCAGGTGGTCACGCCAACGGCAACATCTTTACC
TGGGACACTTCGCGAGCGGCACGGCCCTTTCTTTCGATACCTCACCTTCATGAATCTCGGGTGCAGGATCGGTCG
GCTGACGGCCACATCCCCAACGTCTCTGTCATACACCTAGGTTTTCTGGGAACCCGACATACGGCCCTCGTCTCA
GCCGATGATCGGGGCATGGCCTTCTCGCACCTCGCCACCAGGGGCACGGGTGCGCTTGGCAGAACCGTCAAGACG
ACGAGGATTCTCGGTCGCTATCCGGGCGCACCAACGCCGGCCGGGAAGCCGTTGAAGCCAAGTACCGTCCTCGCA
TTCGCGCCTCTGCCGCTCGGAAACGTGGAGCGTGCCACTGACACCATGGGCCTTACGGCGATGCTCACCCCGTAC
CTGCTCGTGGTCGTATCGACGACGCCGGTGGCCCGCACGCAGCACAAGTCTGCTCGGCCGAAAGAAGTTCCCGCT
CACGCGGCAATGACCGGTTGTCTCGCCTGGTTCCCGGCTGTGAAGCTCAAGGTGCCGGATCCCGCCTCCGGCAGC
GACGTGTCAAAGGTCAAGCTCGTCTATTGCTGGTCCAACGTGCTGACGGTGCTCGACGTGGACGAGACGCCGAGC
GAGGACCCCGACCAGCCGTCGTCGCTCAAGTTCAAGGCCCGCAGCCGGTGGAAGTGCGAGGAGGCCATCGTCGCT
GTCCAGTGGCTGACGCGCTCCGTCTTGACGGTGCTCACCATTTCTCAGAGGCTCATCGTGCTGGAGGACGGGACC
CTACGGATGACCGAGGCTTTCGATTTGCTGCAGAAGCACATCTATCACACCGATCTCTTCTCCAAGCAGCTGCAC
AACTTGGTCGAGCAGCTCGACAACGAGGACGACTCGATGCACGGCGTCGTCGCCGATGCCTTTTACATGAGCTTC
AAGACGTACAAGGGTAGGATATTCCTGCTCGGCTTCAGTGAGGTCTCCATCGGCGCCCTCGCCAACTGGGCGGAC
CGGCTGATTGCCATGATGGAGCACGGCGACTACGTGGGCGCCATCCGTCTGGCGACGTCTTACTACACCGGTGAC
GCCGACAAGCTCACCATTGGCCTTCCCGAGGACGCCAAATTGCGGCATTCCATGGTACAGGAGAAGATTGTCGAG
ATCATGGCTGCCTCGCTCAAGTATGCCTTCGGTCAGAGACTCAGCAATAGCGACAACGCCGACGACGATCAGCTT
CGCCGCCTAGCCGAGGCCTGTTTCGCCGCCTGCCAGGCGATTGGCACGACTGACTACCTCTTCGACGAGGTTTAT
GAACGGTACGAGGCCGCCGCAGTAACGGGCGTCTTCCATGAGACGCTGGAGCCGTATGTTCTCGAAGAGGCCATC
ACGTCGGTGCCGCCGGCCGTCGTCAAGGACCTGGTCGCCTACCACGTTTCACGCGGCTGGGAGGGCCGTCTTGAG
GAGCTCATCTGCCGCATGCAGACGGTCACCTTTGACCTGGATCAGATCACGTCTCTTTGCAAGGAGAACAGCCTG
TACGATGCGCTCATCTACGTCTGGAACCAGGCGCTGGGTGACTACATCAGCCCGATGATGGACCTGCTGAGCTTG
CTGGTGCCGCTGACCACCAACGGCCAGCACGGCGCGGAGGCCTCCGAGGACTACTATGGCGTCAACGCGCTCAAG
ATCTTTCCTTACTTGTCCTACATCCTGACAAGTCGTGCGTATCCGAGCGGGGACCTGATGGACGACGGAGCGGCG
TCGAGGGCCAAGTCGGAAATCTACTGGTTCTTCTTCTCCGGAAAGACCATCGAGTGGCCTAGGGGCAGCGGCCGG
GAGCTGCTGACGCGTCCGCCGGGCGAGGCCGAGCCGGCGTTTCCCTACCTCCGGATGGTGCTCAAGTTTGACGCG
CCCAGCTTCCTGAGTGCGCTGAACGAGGCCTTTGAGGATAGCTTCCTCAATGACTCGCCTGATCGGCGTGTGAAC
GGCGGTGCGGGCGTGGATTTGCCCGAGGAGCAGGTCTTTAGCCTGGCCATCAATCGTCAGTATATTGTGGCGATT
CTCGTCGACGTCATGGGCCCGGACAAGTTTGCGCCCGAGGACACCATCTACCTCGACATGTTTATCGCTCGCAAC
CTGCCCAAGTTCCCGCAATACCTCTTGTTTTCGGGCTCGACGCTCTCGCGGGTGCTGTCCAACCTATGTTCCTAT
CCGGGCGAGGACCTGGCCGAGGACGCCCAGCTCAGCGCCGAATACCTCCTGTCGGTCTACCACCCGTCCGACATG
TCGGCCCTGATGCCGCTATTCAGGGAGGCCGGCTTCTACCGCATACTGAAGCGCATCTACAAGATGGAGAAGCAG
TACGGCAAGCTGGTGGCGACGTACTTTGAGGACCCGGACGATCAGGATGCTGTATTCGACGCCATCTCCGACTGT
CTGCGGCTCCCGGGTGGGACGCCTCTCAACGATCGGCGGAGGCACGAGGTGCTCCGGGTCGTCGAGGAGCGGGCT
CTCGATCTGCTAGAGCTGTGTCCGAGGCGAGCGGCGGCCACACTCGCGTTGCAGGGGGCTGAGTTCCATGCCCGC
ATCGTCGCCTCGGCCGAGGACCGTCCGGAGCTGCAGTTTGCCTACCTCAAGGCTCTGTTGGAGCCTGACGTGGGA
GGGGGAAGGGTGCAGCAGGCCGTGGCACCTGACCGGCAGCTTGTGGAGCATCATGTCCGCCTCATGTGCAGGTTC
GAGCCTCTGCGCGTCTCGGACTACGTCGGCGCGGTGCAGTTTGCGGACCTTCGCCTTGAGGAGCTGTTGCCGACC
ATGGAGGCCACTGGCGTCGTCGATGCCGCCGTGGTGCTGATGGCTCGCGATGGCCAGGCGGAGAAGGCCCTTGAA
CGGCTGGTCAAACACCTCTTTACCCTCGAGTCTGTCGCCCAGGGTCTCCTGAGCGGCGTAGACGAGCTGGACGAC
GCCCCCTACGAGTCGGTGGAAGACGTGCTCCGCGGGCTGCAGAGATACGTCTACGTCGGCATCTGGCTGTGTCAG
GGACAGTCCAAGACGTCCCAACAGAAAAAGGCCATCGTGGTGCAGAAGAAACAGCGAGATACAGGCCAGGACAAG
CTCTCGGCGGACGAGACCCTTTGGGTGAGTCTCATCGACGCCTGTGTCCAGGTGACCAAGCGGCTGTCTCCGGCG
CTGCAGGCGCTGGGGGAAGAAGACGGCGTGAAGCTGGTGCCGCTCCTCCGGTCGCTTGTTCAGCACACCTTTACC
TCGTTGCTCAAGACGACGTCGGGCCAGGCGCACGAGCAGCAGGGTAGCAAGCTCTTGACCAACGCTGGGGCCAAC
CTGTCCTTTCTGCGAATCATGAGGGCCTTTCTCACGCAAGCGGCCGCCTCGTCGCCGGACGTGGCCGACCTGCGT
GAGGTGCTGTCATCCATCTTCGCGGCCTACGCGTACGAAGAGTCGATTCTCAAGCTTTCGAACCGGCTGCTCGAG
CGGAGTCTCTTCGTCAACGTCAAGCAGGCTGTCGACCTGAGGCAGCGCGGCTGGCGCCCTCGAGGTTCCACGTGC
GAGGCCTGTGGTAGAAGAGTCTGGGGGCCCGGTGTAGCCGGCGGCGCCGTTCTCGATGCCTGGGAGGAGCGGCAG
TCGCTCGAAGAGGCGAGGAGGAGAGACCGCAAGGCGAGCAGGGCTAGAATCGACGGCGGCGAGGGCGTATTCGAG
GGTAGGGATAAGGGAAAGAGCCCGGACAGGAGCGCGGTGGCGGATGCGCATGTTACCGGGCTGGAGGAAGCATCG
GGGACTGTGGCGGACGGCGTCGTCAGGGAGGCTTCCAGCGGGCCGCTGGTGGTGTTGGCGTGCCGGCATATCTTT
CACCTGAGCTGCCTCGAGCCGCTGCAGGAAGGGCGGGAGAACGGGGGCTCGGGTAGGGAGAGGGGGTTCAAGTGC
CCTGTCGACGGGTAG
Transcript >Ophun1|3093
ATGTCTGACCCACAAGACACGTCTCCGACGCGAGACGAAGGAGTCGATGAGCCGGACGCTGATGTCCTCCAGATG
GAGCCGCAGCAGGACCGTCCGGTGACGCCCGAGGCCAGTCTGCGTCCTTCGGCCGGGCCGCGGCTCCGGAGCGGC
TCCTTGCTGAGCTCGGCGGATGTGAGCCTGAGCTTGGTGGAAGGGCTGCCGAGGAGGGCTGGAAGTCCTGTTGAA
TCGCTGGCTTCTGGCATGGGGAATACGCCCGTCTTGCCCTCGGCAGCGACTCGTCCCGGCCTCGGCAGTCCGTCG
CCTTCGTTTCGGCCTTTTGATCGCCGCTTTCACGCTCGCTACTCGCCCTCGCCGACGAGCACTCCGCGCGGCTCG
TCGCCCGCCTTTGTCTCAGGCCACAGCCGGAACGTGTCGTTCATGTCGAATTTGCCCCTCGACCAGGCTGACACG
GACACGCCTTCTGCGCCCTGGGATGTTGTTCGCTGGACCAGGCTCAAGAAGCTTAACAATAGTGCCTTTTCGGAG
CTGGGCAGGCGTAACTTTGGCTCGCCGACTTGTGTTGCGGTTTCGACTTCCATTGTGCTGGGGACGTCCAAGGGA
ATAATCTTAATGTTTGATTACCACCAGAATATCAAGATGATCATCGGTCAGGGCACGCAAGCCGTCGAGTCCGGC
CCCGTCACGTCCATCGCTGTCTCTGCCGACCACAGCACCATTGCAGGTGGTCACGCCAACGGCAACATCTTTACC
TGGGACACTTCGCGAGCGGCACGGCCCTTTCTTTCGATACCTCACCTTCATGAATCTCGGGTGCAGGATCGGTCG
GCTGACGGCCACATCCCCAACGTCTCTGTCATACACCTAGGTTTTCTGGGAACCCGACATACGGCCCTCGTCTCA
GCCGATGATCGGGGCATGGCCTTCTCGCACCTCGCCACCAGGGGCACGGGTGCGCTTGGCAGAACCGTCAAGACG
ACGAGGATTCTCGGTCGCTATCCGGGCGCACCAACGCCGGCCGGGAAGCCGTTGAAGCCAAGTACCGTCCTCGCA
TTCGCGCCTCTGCCGCTCGGAAACGTGGAGCGTGCCACTGACACCATGGGCCTTACGGCGATGCTCACCCCGTAC
CTGCTCGTGGTCGTATCGACGACGCCGGTGGCCCGCACGCAGCACAAGTCTGCTCGGCCGAAAGAAGTTCCCGCT
CACGCGGCAATGACCGGTTGTCTCGCCTGGTTCCCGGCTGTGAAGCTCAAGGTGCCGGATCCCGCCTCCGGCAGC
GACGTGTCAAAGGTCAAGCTCGTCTATTGCTGGTCCAACGTGCTGACGGTGCTCGACGTGGACGAGACGCCGAGC
GAGGACCCCGACCAGCCGTCGTCGCTCAAGTTCAAGGCCCGCAGCCGGTGGAAGTGCGAGGAGGCCATCGTCGCT
GTCCAGTGGCTGACGCGCTCCGTCTTGACGGTGCTCACCATTTCTCAGAGGCTCATCGTGCTGGAGGACGGGACC
CTACGGATGACCGAGGCTTTCGATTTGCTGCAGAAGCACATCTATCACACCGATCTCTTCTCCAAGCAGCTGCAC
AACTTGGTCGAGCAGCTCGACAACGAGGACGACTCGATGCACGGCGTCGTCGCCGATGCCTTTTACATGAGCTTC
AAGACGTACAAGGGTAGGATATTCCTGCTCGGCTTCAGTGAGGTCTCCATCGGCGCCCTCGCCAACTGGGCGGAC
CGGCTGATTGCCATGATGGAGCACGGCGACTACGTGGGCGCCATCCGTCTGGCGACGTCTTACTACACCGGTGAC
GCCGACAAGCTCACCATTGGCCTTCCCGAGGACGCCAAATTGCGGCATTCCATGGTACAGGAGAAGATTGTCGAG
ATCATGGCTGCCTCGCTCAAGTATGCCTTCGGTCAGAGACTCAGCAATAGCGACAACGCCGACGACGATCAGCTT
CGCCGCCTAGCCGAGGCCTGTTTCGCCGCCTGCCAGGCGATTGGCACGACTGACTACCTCTTCGACGAGGTTTAT
GAACGGTACGAGGCCGCCGCAGTAACGGGCGTCTTCCATGAGACGCTGGAGCCGTATGTTCTCGAAGAGGCCATC
ACGTCGGTGCCGCCGGCCGTCGTCAAGGACCTGGTCGCCTACCACGTTTCACGCGGCTGGGAGGGCCGTCTTGAG
GAGCTCATCTGCCGCATGCAGACGGTCACCTTTGACCTGGATCAGATCACGTCTCTTTGCAAGGAGAACAGCCTG
TACGATGCGCTCATCTACGTCTGGAACCAGGCGCTGGGTGACTACATCAGCCCGATGATGGACCTGCTGAGCTTG
CTGGTGCCGCTGACCACCAACGGCCAGCACGGCGCGGAGGCCTCCGAGGACTACTATGGCGTCAACGCGCTCAAG
ATCTTTCCTTACTTGTCCTACATCCTGACAAGTCGTGCGTATCCGAGCGGGGACCTGATGGACGACGGAGCGGCG
TCGAGGGCCAAGTCGGAAATCTACTGGTTCTTCTTCTCCGGAAAGACCATCGAGTGGCCTAGGGGCAGCGGCCGG
GAGCTGCTGACGCGTCCGCCGGGCGAGGCCGAGCCGGCGTTTCCCTACCTCCGGATGGTGCTCAAGTTTGACGCG
CCCAGCTTCCTGAGTGCGCTGAACGAGGCCTTTGAGGATAGCTTCCTCAATGACTCGCCTGATCGGCGTGTGAAC
GGCGGTGCGGGCGTGGATTTGCCCGAGGAGCAGGTCTTTAGCCTGGCCATCAATCGTCAGTATATTGTGGCGATT
CTCGTCGACGTCATGGGCCCGGACAAGTTTGCGCCCGAGGACACCATCTACCTCGACATGTTTATCGCTCGCAAC
CTGCCCAAGTTCCCGCAATACCTCTTGTTTTCGGGCTCGACGCTCTCGCGGGTGCTGTCCAACCTATGTTCCTAT
CCGGGCGAGGACCTGGCCGAGGACGCCCAGCTCAGCGCCGAATACCTCCTGTCGGTCTACCACCCGTCCGACATG
TCGGCCCTGATGCCGCTATTCAGGGAGGCCGGCTTCTACCGCATACTGAAGCGCATCTACAAGATGGAGAAGCAG
TACGGCAAGCTGGTGGCGACGTACTTTGAGGACCCGGACGATCAGGATGCTGTATTCGACGCCATCTCCGACTGT
CTGCGGCTCCCGGGTGGGACGCCTCTCAACGATCGGCGGAGGCACGAGGTGCTCCGGGTCGTCGAGGAGCGGGCT
CTCGATCTGCTAGAGCTGTGTCCGAGGCGAGCGGCGGCCACACTCGCGTTGCAGGGGGCTGAGTTCCATGCCCGC
ATCGTCGCCTCGGCCGAGGACCGTCCGGAGCTGCAGTTTGCCTACCTCAAGGCTCTGTTGGAGCCTGACGTGGGA
GGGGGAAGGGTGCAGCAGGCCGTGGCACCTGACCGGCAGCTTGTGGAGCATCATGTCCGCCTCATGTGCAGGTTC
GAGCCTCTGCGCGTCTCGGACTACGTCGGCGCGGTGCAGTTTGCGGACCTTCGCCTTGAGGAGCTGTTGCCGACC
ATGGAGGCCACTGGCGTCGTCGATGCCGCCGTGGTGCTGATGGCTCGCGATGGCCAGGCGGAGAAGGCCCTTGAA
CGGCTGGTCAAACACCTCTTTACCCTCGAGTCTGTCGCCCAGGGTCTCCTGAGCGGCGTAGACGAGCTGGACGAC
GCCCCCTACGAGTCGGTGGAAGACGTGCTCCGCGGGCTGCAGAGATACGTCTACGTCGGCATCTGGCTGTGTCAG
GGACAGTCCAAGACGTCCCAACAGAAAAAGGCCATCGTGGTGCAGAAGAAACAGCGAGATACAGGCCAGGACAAG
CTCTCGGCGGACGAGACCCTTTGGGTGAGTCTCATCGACGCCTGTGTCCAGGTGACCAAGCGGCTGTCTCCGGCG
CTGCAGGCGCTGGGGGAAGAAGACGGCGTGAAGCTGGTGCCGCTCCTCCGGTCGCTTGTTCAGCACACCTTTACC
TCGTTGCTCAAGACGACGTCGGGCCAGGCGCACGAGCAGCAGGGTAGCAAGCTCTTGACCAACGCTGGGGCCAAC
CTGTCCTTTCTGCGAATCATGAGGGCCTTTCTCACGCAAGCGGCCGCCTCGTCGCCGGACGTGGCCGACCTGCGT
GAGGTGCTGTCATCCATCTTCGCGGCCTACGCGTACGAAGAGTCGATTCTCAAGCTTTCGAACCGGCTGCTCGAG
CGGAGTCTCTTCGTCAACGTCAAGCAGGCTGTCGACCTGAGGCAGCGCGGCTGGCGCCCTCGAGGTTCCACGTGC
GAGGCCTGTGGTAGAAGAGTCTGGGGGCCCGGTGTAGCCGGCGGCGCCGTTCTCGATGCCTGGGAGGAGCGGCAG
TCGCTCGAAGAGGCGAGGAGGAGAGACCGCAAGGCGAGCAGGGCTAGAATCGACGGCGGCGAGGGCGTATTCGAG
GGTAGGGATAAGGGAAAGAGCCCGGACAGGAGCGCGGTGGCGGATGCGCATGTTACCGGGCTGGAGGAAGCATCG
GGGACTGTGGCGGACGGCGTCGTCAGGGAGGCTTCCAGCGGGCCGCTGGTGGTGTTGGCGTGCCGGCATATCTTT
CACCTGAGCTGCCTCGAGCCGCTGCAGGAAGGGCGGGAGAACGGGGGCTCGGGTAGGGAGAGGGGGTTCAAGTGC
CCTGTCGACGGGTAG
Gene >Ophun1|3093
ATGTCTGACCCACAAGACACGTCTCCGACGCGAGACGAAGGAGTCGATGAGCCGGACGCTGATGTCCTCCAGATG
GAGCCGCAGCAGGACCGTCCGGTGACGCCCGAGGCCAGTCTGCGTCCTTCGGCCGGGCCGCGGCTCCGGAGCGGC
TCCTTGCTGAGCTCGGCGGATGTGAGCCTGAGCTTGGTGGAAGGGCTGCCGAGGAGGGCTGGAAGTCCTGTTGAA
TCGCTGGCTTCTGGCATGGGGAATACGCCGTCTTTGCAGGCGAGTTGCCGATGTCTTCTCTTGCTTCGTGCAGCT
GACGTCTGAGTGTGTGTGAGAGTTCGCAGGGATCTCTCATGTCTTCTCCTGGGAGCAGCGTCTTGCCCTCGGCAG
CGACTCGTCCCGGCCTCGGCAGTCCGTCGCCTTCGTTTCGGCCTTTTGATCGCCGCTTTCACGCTCGCTACTCGC
CCTCGCCGACGAGCACTCCGCGCGGCTCGTCGCCCGCCTTTGTCTCAGGCCACAGCCGGAACGTGTCGTTCATGT
CGAATTTGCCCCTCGACCAGGCTGACACGGACACGCCTTCTGCGCCCTGGGATGTTGTTCGCTGGACCAGGCTCA
AGAAGCTTAACAATAGTGCCTTTTCGGAGCTGGGCAGGCGTAACTTTGGCTCGCCGACTTGTGTTGCGGTTTCGA
CTTCCATTGTGCTGGGGACGTCCAAGGGAATAATCTTAATGTTTGATTACCACCAGAATATCAAGATGATCATCG
GTCAGGGCACGCAAGGTGAGGAGAGCACGACCCCTTTGCGGGCTGGTGCTAATTCGAGCTCTAGCCGTCGAGTCC
GGCCCCGTCACGTCCATCGCTGTCTCTGCCGACCACAGCACCATTGCAGGTGGTCACGCCAACGGCAACATCTTT
ACCTGGGACACTTCGCGAGCGGCACGGCCCTTTCTTTCGATACCTCACCTTCATGAATCTCGGGTGCAGGATCGG
TCGGCTGACGGCCACATCCCCAACGTCTCTGTCATACACCTAGGTTTTCTGGGAACCCGACATACGGCCCTCGTC
TCAGCCGATGATCGGGGCATGGCCTTCTCGCACCTCGCCACCAGGGGCACGGGTGCGCTTGGCAGAACCGTCAAG
ACGACGAGGATTCTCGGTCGCTATCCGGGCGCACCAACGCCGGCCGGGAAGCCGTTGAAGCCAAGTACCGTCCTC
GCATTCGCGCCTCTGCCGCTCGGAAACGTGGAGCGTGCCACTGACACCATGGGCCTTACGGCGATGCTCACCCCG
TACCTGCTCGTGGTCGTATCGACGACGCCGGTGGCCCGCACGCAGCACAAGTCTGCTCGGCCGAAAGAAGTTCCC
GCTCACGCGGCAATGACCGGTTGTCTCGCCTGGTTCCCGGCTGTGAAGCTCAAGGTGCCGGATCCCGCCTCCGGC
AGCGACGTGTCAAAGGTCAAGCTCGTCTATTGCTGGTCCAACGTGCTGACGGTGCTCGACGTGGACGAGACGCCG
AGCGAGGACCCCGACCAGCCGTCGTCGCTCAAGTTCAAGGCCCGCAGCCGGTGGAAGTGCGAGGAGGCCATCGTC
GCTGTCCAGTGGCTGACGCGCTCCGTCTTGACGGTGCTCACCATTTCTCAGAGGCTCATCGTGCTGGAGGACGGG
ACCCTACGGATGACCGAGGCTTTCGATTTGCTGCAGAAGCACATCTATCACACCGATCTCTTCTCCAAGCAGCTG
CACAACTTGGTCGAGCAGCTCGACAACGAGGACGACTCGATGCACGGCGTCGTCGCCGATGCCTTTTACATGAGC
TTCAAGACGTACAAGGGTAGGATATTCCTGCTCGGCTTCAGTGAGGTCTCCATCGGCGCCCTCGCCAACTGGGCG
GACCGGCTGATTGCCATGATGGAGCACGGCGACTACGTGGGCGCCATCCGTCTGGCGACGTCTTACTACACCGGT
GACGCCGACAAGCTCACCATTGGCCTTCCCGAGGACGCCAAATTGCGGCATTCCATGGTACAGGAGAAGATTGTC
GAGATCATGGCTGCCTCGCTCAAGTATGCCTTCGGTCAGAGACTCAGCAATAGCGACAACGCCGACGACGATCAG
CTTCGCCGCCTAGCCGAGGCCTGTTTCGCCGCCTGCCAGGCGATTGGCACGACTGACTACCTCTTCGACGAGGTT
TATGAACGGTACGAGGCCGCCGCAGTAACGGGCGTCTTCCATGAGACGCTGGAGCCGTATGTTCTCGAAGAGGCC
ATCACGTCGGTGCCGCCGGCCGTCGTCAAGGACCTGGTCGCCTACCACGTTTCACGCGGCTGGGAGGGCCGTCTT
GAGGAGCTCATCTGCCGCATGCAGACGGTCACCTTTGACCTGGATCAGATCACGTCTCTTTGCAAGGAGAACAGC
CTGTACGATGCGCTCATCTACGTCTGGAACCAGGCGCTGGGTGACTACATCAGCCCGATGATGGACCTGCTGAGC
TTGCTGGTGCCGCTGACCACCAACGGCCAGCACGGCGCGGAGGCCTCCGAGGACTACTATGGCGTCAACGCGCTC
AAGATCTTTCCTTACTTGTCCTACATCCTGACAAGTCGTGCGTATCCGAGCGGGGACCTGATGGACGACGGAGCG
GCGTCGAGGGCCAAGTCGGAAATCTACTGGTTCTTCTTCTCCGGAAAGACCATCGAGTGGCCTAGGGGCAGCGGC
CGGGAGCTGCTGACGCGTCCGCCGGGCGAGGCCGAGCCGGCGTTTCCCTACCTCCGGATGGTGCTCAAGTTTGAC
GCGCCCAGCTTCCTGAGTGCGCTGAACGAGGCCTTTGAGGATAGCTTCCTCAATGACTCGCCTGATCGGCGTGTG
AACGGCGGTGCGGGCGTGGATTTGCCCGAGGAGCAGGTCTTTAGCCTGGCCATCAATCGTCAGTATATTGTGGCG
ATTCTCGTCGACGTCATGGGCCCGGACAAGTTTGCGCCCGAGGACACCATCTACCTCGACATGTTTATCGCTCGC
AACCTGCCCAAGTTCCCGCAATACCTCTTGTTTTCGGGCTCGACGCTCTCGCGGGTGCTGTCCAACCTATGTTCC
TATCCGGGCGAGGACCTGGCCGAGGACGCCCAGCTCAGCGCCGAATACCTCCTGTCGGTCTACCACCCGTCCGAC
ATGTCGGCCCTGATGCCGCTATTCAGGGAGGCCGGCTTCTACCGCATACTGAAGCGCATCTACAAGATGGAGAAG
CAGTACGGCAAGCTGGTGGCGACGTACTTTGAGGACCCGGACGATCAGGATGCTGTATTCGACGCCATCTCCGAC
TGTCTGCGGCTCCCGGGTGGGACGCCTCTCAACGATCGGCGGAGGCACGAGGTGCTCCGGGTCGTCGAGGAGCGG
GCTCTCGATCTGCTAGAGCTGTGTCCGAGGCGAGCGGCGGCCACACTCGCGTTGCAGGGGGCTGAGTTCCATGCC
CGCATCGTCGCCTCGGCCGAGGACCGTCCGGAGCTGCAGTTTGCCTACCTCAAGGCTCTGTTGGAGCCTGACGTG
GGAGGGGGAAGGGTGCAGCAGGCCGTGGCACCTGACCGGCAGCTTGTGGAGCATCATGTCCGCCTCATGTGCAGG
TTCGAGCCTCTGCGCGTCTCGGACTACGTCGGCGCGGTGCAGTTTGCGGACCTTCGCCTTGAGGAGCTGTTGCCG
ACCATGGAGGCCACTGGCGTCGTCGATGCCGCCGTGGTGCTGATGGCTCGCGATGGCCAGGCGGAGAAGGCCCTT
GAACGGCTGGTCAAACACCTCTTTACCCTCGAGTCTGTCGCCCAGGGTCTCCTGAGCGGCGTAGACGAGCTGGAC
GACGCCCCCTACGAGTCGGTGGAAGACGTGCTCCGCGGGCTGCAGAGATACGTCTACGTCGGCATCTGGCTGTGT
CAGGGACAGTCCAAGACGTCCCAACAGAAAAAGGCCATCGTGGTGCAGAAGAAACAGCGAGATACAGGCCAGGAC
AAGCTCTCGGCGGACGAGACCCTTTGGGTGAGTCTCATCGACGCCTGTGTCCAGGTGACCAAGCGGCTGTCTCCG
GCGCTGCAGGCGCTGGGGGAAGAAGACGGCGTGAAGCTGGTGCCGCTCCTCCGGTCGCTTGTTCAGCACACCTTT
ACCTCGTTGCTCAAGACGACGTCGGGCCAGGCGCACGAGCAGCAGGGTAGCAAGCTCTTGACCAACGCTGGGGCC
AACCTGTCCTTTCTGCGAATCATGAGGGCCTTTCTCACGCAAGCGGCCGCCTCGTCGCCGGACGTGGCCGACCTG
CGTGAGGTGCTGTCATCCATCTTCGCGGCCTACGCGTACGAAGAGTCGATTCTCAAGCTTTCGAACCGGCTGCTC
GAGCGGAGTCTCTTCGTCAACGTCAAGCAGGCTGTCGACCTGAGGCAGCGCGGCTGGCGCCCTCGAGGTTCCACG
TGCGAGGCCTGTGGTAGAAGAGTCTGGGGGCCCGGTGTAGCCGGCGGCGCCGTTCTCGATGCCTGGGAGGAGCGG
CAGTCGCTCGAAGAGGCGAGGAGGAGAGACCGCAAGGCGAGCAGGGCTAGAATCGACGGCGGCGAGGGCGTATTC
GAGGGTAGGGATAAGGGAAAGAGCCCGGACAGGAGCGCGGTGGCGGATGCGCATGTTACCGGGCTGGAGGAAGCA
TCGGGGACTGTGGCGGACGGCGTCGTCAGGGAGGCTTCCAGCGGGCCGCTGGTGGTGTTGGCGTGCCGGCATATC
TTTCACCTGAGCTGCCTCGAGCCGCTGCAGGAAGGGCGGGAGAACGGGGGCTCGGGTAGGGAGAGGGGGTTCAAG
TGCCCTGTCGACGGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail