Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3092
Gene name
LocationContig_275:9382..10264
Strand-
Gene length (bp)882
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12572 DUF3752 Protein of unknown function (DUF3752) 1.3E-44 135 288

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q93591|YUBO_CAEEL Uncharacterized protein F26A3.7 OS=Caenorhabditis elegans GN=F26A3.7 PE=4 SV=2 3 287 5.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5883
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|779
Ophiocordyceps australis map64 (Brazil) OphauB2|4400
Ophiocordyceps camponoti-floridani Ophcf2|02264
Ophiocordyceps camponoti-rufipedis Ophun1|3092 (this protein)
Ophiocordyceps kimflemingae Ophio5|5875

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3092
MASIGPQLPAQTIKRKRTPSISSSEEPQGPSPQEPANKTNADEIDLDLDADADDDTSGPAIGPSLPSSSTIKSTI
GPSLPPPSTSNKPPSADPDSDSDSYGPSLPSAATRPTIGPSLPPAHSESAPQRDSWMLAPPSANTTYTERDPTRL
RARKFASKPTAAPPPPSSSNAPSVWTETPEEKLRRLQDSVLGRSAPEPQTASQGRSAEVTRERESNIAATVKAQR
GSSLYDQHDKKRRRGGVARGEEEDDPSKRAFDRDKDMALGGKIGTAQRRELVSKSANFGGRFQKGSYL*
Coding >Ophun1|3092
ATGGCGTCGATAGGGCCTCAGCTTCCAGCGCAGACCATCAAGCGCAAACGAACTCCTTCCATCTCCTCCTCAGAA
GAGCCACAAGGCCCCTCTCCCCAAGAACCAGCAAACAAGACCAACGCCGACGAAATCGACCTCGACCTCGACGCC
GACGCAGACGACGACACCTCGGGTCCCGCCATTGGCCCCTCTCTTCCGTCCTCCTCAACCATCAAGAGCACCATC
GGTCCCTCTCTGCCGCCGCCTTCCACCTCCAACAAACCGCCATCCGCCGACCCCGATTCCGACTCCGACTCCTAC
GGCCCATCCCTCCCATCCGCCGCCACCCGCCCGACAATCGGCCCCTCTCTCCCCCCGGCCCACTCAGAAAGCGCC
CCCCAGCGCGACAGCTGGATGCTAGCCCCCCCATCCGCGAACACCACCTACACCGAGCGCGACCCTACACGCCTC
CGGGCCCGCAAGTTCGCCTCCAAGCCAACGGCCGCCCCTCCGCCGCCATCGTCTTCGAACGCGCCGTCTGTCTGG
ACCGAGACACCCGAGGAGAAGCTGCGTCGTCTGCAGGACTCGGTCCTCGGCCGCTCAGCCCCCGAACCACAGACG
GCATCGCAGGGCCGCTCGGCCGAAGTTACCCGCGAGCGAGAGAGCAACATAGCGGCTACCGTCAAAGCTCAGCGC
GGCTCGAGTCTCTACGATCAGCACGACAAGAAGCGCAGGCGCGGCGGAGTCGCAAGAGGCGAAGAAGAGGACGAT
CCCAGCAAGAGGGCCTTTGACAGAGATAAAGACATGGCTCTGGGCGGCAAGATCGGTACGGCACAGAGACGGGAG
CTCGTCTCCAAGTCGGCCAATTTCGGCGGCAGGTTTCAGAAGGGTTCATACTTGTAA
Transcript >Ophun1|3092
ATGGCGTCGATAGGGCCTCAGCTTCCAGCGCAGACCATCAAGCGCAAACGAACTCCTTCCATCTCCTCCTCAGAA
GAGCCACAAGGCCCCTCTCCCCAAGAACCAGCAAACAAGACCAACGCCGACGAAATCGACCTCGACCTCGACGCC
GACGCAGACGACGACACCTCGGGTCCCGCCATTGGCCCCTCTCTTCCGTCCTCCTCAACCATCAAGAGCACCATC
GGTCCCTCTCTGCCGCCGCCTTCCACCTCCAACAAACCGCCATCCGCCGACCCCGATTCCGACTCCGACTCCTAC
GGCCCATCCCTCCCATCCGCCGCCACCCGCCCGACAATCGGCCCCTCTCTCCCCCCGGCCCACTCAGAAAGCGCC
CCCCAGCGCGACAGCTGGATGCTAGCCCCCCCATCCGCGAACACCACCTACACCGAGCGCGACCCTACACGCCTC
CGGGCCCGCAAGTTCGCCTCCAAGCCAACGGCCGCCCCTCCGCCGCCATCGTCTTCGAACGCGCCGTCTGTCTGG
ACCGAGACACCCGAGGAGAAGCTGCGTCGTCTGCAGGACTCGGTCCTCGGCCGCTCAGCCCCCGAACCACAGACG
GCATCGCAGGGCCGCTCGGCCGAAGTTACCCGCGAGCGAGAGAGCAACATAGCGGCTACCGTCAAAGCTCAGCGC
GGCTCGAGTCTCTACGATCAGCACGACAAGAAGCGCAGGCGCGGCGGAGTCGCAAGAGGCGAAGAAGAGGACGAT
CCCAGCAAGAGGGCCTTTGACAGAGATAAAGACATGGCTCTGGGCGGCAAGATCGGTACGGCACAGAGACGGGAG
CTCGTCTCCAAGTCGGCCAATTTCGGCGGCAGGTTTCAGAAGGGTTCATACTTGTAA
Gene >Ophun1|3092
ATGGCGTCGATAGGGCCTCAGCTTCCAGCGCAGACCATCAAGCGCAAACGAACTCCTTCCATCTCCTCCTCAGAA
GAGCCACAAGGCCCCTCTCCCCAAGAACCAGCAAACAAGACCAACGCCGACGAAATCGACCTCGACCTCGACGCC
GACGCAGACGACGACACCTCGGGTCCCGCCATTGGCCCCTCTCTTCCGTCCTCCTCAACCATCAAGAGCACCATC
GGTCCCTCTCTGCCGCCGCCTTCCACCTCCAACAAACCGCCATCCGCCGACCCCGATTCCGACTCCGACTCCTAC
GGCCCATCCCTCCCATCCGCCGCCACCCGCCCGACAATCGGCCCCTCTCTCCCCCCGGCCCACTCAGAAAGCGCC
CCCCAGCGCGACAGCTGGATGCTAGCCCCCCCATCCGCGAACACCACCTACACCGAGCGCGACCCTACACGCCTC
CGGGCCCGCAAGTTCGCCTCCAAGCCAACGGCCGCCCCTCCGCCGCCATCGTCTTCGAACGCGCCGTCTGTCTGG
ACCGAGACACCCGAGGAGAAGCTGCGTCGTCTGCAGGACTCGGTCCTCGGCCGCTCAGCCCCCGAACCACAGACG
GCATCGCAGGGCCGCTCGGCCGAAGTTACCCGCGAGCGAGAGAGCAACATAGCGGCTACCGTCAAAGCTCAGCGC
GGCTCGAGTCTCTACGATCAGCACGACAAGAAGCGCAGGCGCGGCGGAGTCGCAAGAGGCGAAGAAGAGGACGAT
CCCAGCAAGAGGGCCTTTGACAGAGATAAAGACATGGCTCTGGGCGGCAAGATCGGTACGGCACAGAGACGGGAG
CTCGTCTCCAAGTCGGCCAATTTCGGCGGCAGGTTTCAGAAGGGTTCATACTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail