Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3084
Gene name
LocationContig_274:8008..8515
Strand+
Gene length (bp)507
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04281 Tom22 Mitochondrial import receptor subunit Tom22 3.6E-45 1 128

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q07335|TOM22_NEUCR Mitochondrial import receptor subunit tom22 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom22 PE=2 SV=1 1 143 3.0E-36
sp|O13813|TOM22_SCHPO Mitochondrial import receptor subunit tom22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom22 PE=3 SV=1 1 127 3.0E-14
sp|P49334|TOM22_YEAST Mitochondrial import receptor subunit TOM22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM22 PE=1 SV=3 42 135 3.0E-07

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0005741 mitochondrial outer membrane Yes
GO:0033036 macromolecule localization No
GO:0098588 bounding membrane of organelle No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0019867 outer membrane No
GO:0046907 intracellular transport No
GO:0031968 organelle outer membrane No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0031966 mitochondrial membrane No
GO:0071705 nitrogen compound transport No
GO:0031090 organelle membrane No
GO:0051179 localization No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No
GO:0071702 organic substance transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 86 105 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3084
MVTLTEVEDEHFHDQTGDEINDDDFTDTDSEISNESDYEPTGESFAERLLALRDVIPPTTRGWVSNHVTSFSTKA
WSILSFSGKGAWVITTSALFFGVPFALSFAEDQQIMAMDQEMSMRQTGNDLMTAEPEKSADEKAAAVGTVDVTTQ
H*
Coding >Ophun1|3084
ATGGTGACGCTCACCGAAGTAGAGGACGAGCATTTCCATGACCAAACCGGTGACGAAATCAACGATGATGACTTC
ACCGACACCGACTCGGAGATATCAAACGAGTCCGACTATGAACCCACAGGCGAGTCGTTTGCTGAGCGGCTACTC
GCTCTTCGCGACGTGATCCCGCCAACCACCAGGGGCTGGGTCTCCAACCACGTCACCTCCTTCTCCACCAAGGCA
TGGAGCATCCTATCCTTCAGCGGCAAGGGCGCATGGGTCATCACCACATCGGCTCTCTTCTTCGGCGTTCCCTTT
GCCCTCTCCTTCGCAGAGGACCAGCAGATTATGGCCATGGATCAGGAGATGAGCATGCGTCAGACGGGCAATGAT
CTGATGACGGCTGAGCCTGAGAAGAGCGCTGATGAAAAGGCCGCCGCTGTTGGAACGGTTGATGTCACTACTCAA
CATTGA
Transcript >Ophun1|3084
ATGGTGACGCTCACCGAAGTAGAGGACGAGCATTTCCATGACCAAACCGGTGACGAAATCAACGATGATGACTTC
ACCGACACCGACTCGGAGATATCAAACGAGTCCGACTATGAACCCACAGGCGAGTCGTTTGCTGAGCGGCTACTC
GCTCTTCGCGACGTGATCCCGCCAACCACCAGGGGCTGGGTCTCCAACCACGTCACCTCCTTCTCCACCAAGGCA
TGGAGCATCCTATCCTTCAGCGGCAAGGGCGCATGGGTCATCACCACATCGGCTCTCTTCTTCGGCGTTCCCTTT
GCCCTCTCCTTCGCAGAGGACCAGCAGATTATGGCCATGGATCAGGAGATGAGCATGCGTCAGACGGGCAATGAT
CTGATGACGGCTGAGCCTGAGAAGAGCGCTGATGAAAAGGCCGCCGCTGTTGGAACGGTTGATGTCACTACTCAA
CATTGA
Gene >Ophun1|3084
ATGGTGACGCTCACCGAAGTAGAGGACGAGCATTTCCATGACCAAACCGGTGACGAAATCAACGATGATGACTTC
ACCGACACCGGTTCGTATCCCTCCGCCGTCGCGCCTCTCCAACGCTGACCTCTCCCGTCAGACTCGGAGATATCA
AACGAGTCCGACTATGAACCCACAGGCGAGTCGTTTGCTGAGCGGCTACTCGCTCTTCGCGACGTGATCCCGCCA
ACCACCAGGGGCTGGGTCTCCAACCACGTCACCTCCTTCTCCACCAAGGCATGGAGCATCCTATCCTTCAGCGGC
AAGGGCGCATGGGTCATCACCACATCGGCTCTCTTCTTCGGCGTTCCCTTTGCCCTCTCCTTCGCAGAGGACCAG
CAGATTATGGCCATGGATCAGGAGATGAGCATGCGTCAGACGGGCAATGATCTGATGACGGCTGAGCCTGAGAAG
AGCGCTGATGAAAAGGCCGCCGCTGTTGGAACGGTTGATGTCACTACTCAACATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail