Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3079
Gene name
LocationContig_273:14226..14919
Strand+
Gene length (bp)693
Transcript length (bp)456
Coding sequence length (bp)456
Protein length (aa) 152

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08069 Ribosomal_S13_N Ribosomal S13/S15 N-terminal domain 3.0E-29 1 60
PF00312 Ribosomal_S15 Ribosomal protein S15 4.0E-14 74 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P33192|RS13_CANMA 40S ribosomal protein S13 OS=Candida maltosa GN=RPS13 PE=3 SV=2 1 151 5.0E-89
sp|P05756|RS13_YEAST 40S ribosomal protein S13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS13 PE=1 SV=3 1 150 1.0E-85
sp|P59223|RS131_ARATH 40S ribosomal protein S13-1 OS=Arabidopsis thaliana GN=RPS13A PE=2 SV=1 1 151 2.0E-85
sp|P28189|RS13_SCHPO 40S ribosomal protein S13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps13 PE=1 SV=2 1 151 3.0E-84
sp|P59224|RS132_ARATH 40S ribosomal protein S13-2 OS=Arabidopsis thaliana GN=RPS13B PE=2 SV=1 1 151 4.0E-84
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P33192|RS13_CANMA 40S ribosomal protein S13 OS=Candida maltosa GN=RPS13 PE=3 SV=2 1 151 5.0E-89
sp|P05756|RS13_YEAST 40S ribosomal protein S13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS13 PE=1 SV=3 1 150 1.0E-85
sp|P59223|RS131_ARATH 40S ribosomal protein S13-1 OS=Arabidopsis thaliana GN=RPS13A PE=2 SV=1 1 151 2.0E-85
sp|P28189|RS13_SCHPO 40S ribosomal protein S13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps13 PE=1 SV=2 1 151 3.0E-84
sp|P59224|RS132_ARATH 40S ribosomal protein S13-2 OS=Arabidopsis thaliana GN=RPS13B PE=2 SV=1 1 151 4.0E-84
sp|P62302|RS13_SOYBN 40S ribosomal protein S13 OS=Glycine max GN=RPS13 PE=2 SV=1 1 151 3.0E-83
sp|P62278|RS13_RAT 40S ribosomal protein S13 OS=Rattus norvegicus GN=Rps13 PE=1 SV=2 1 151 4.0E-83
sp|P62301|RS13_MOUSE 40S ribosomal protein S13 OS=Mus musculus GN=Rps13 PE=1 SV=2 1 151 4.0E-83
sp|P62277|RS13_HUMAN 40S ribosomal protein S13 OS=Homo sapiens GN=RPS13 PE=1 SV=2 1 151 4.0E-83
sp|Q6ITC7|RS13_CHICK 40S ribosomal protein S13 OS=Gallus gallus GN=RPS13 PE=2 SV=3 1 151 4.0E-83
sp|Q56JX8|RS13_BOVIN 40S ribosomal protein S13 OS=Bos taurus GN=RPS13 PE=2 SV=3 1 151 4.0E-83
sp|P49393|RS13_XENLA 40S ribosomal protein S13 OS=Xenopus laevis GN=rps13 PE=3 SV=2 1 151 5.0E-83
sp|Q9WVH0|RS13_CRIGR 40S ribosomal protein S13 OS=Cricetulus griseus GN=RPS13 PE=3 SV=3 1 151 3.0E-82
sp|P78571|RS13_AGABI 40S ribosomal protein S13 OS=Agaricus bisporus GN=RPS13 PE=2 SV=1 1 151 4.0E-82
sp|O77303|RS13_LUMRU 40S ribosomal protein S13 OS=Lumbricus rubellus GN=RPS13 PE=2 SV=3 1 151 7.0E-82
sp|P47772|RS13_ICTPU 40S ribosomal protein S13 OS=Ictalurus punctatus GN=rps13 PE=2 SV=3 1 151 8.0E-82
sp|P46298|RS13_PEA 40S ribosomal protein S13 OS=Pisum sativum GN=RPS13 PE=2 SV=1 1 151 1.0E-81
sp|Q9DFR6|RS13_GILMI 40S ribosomal protein S13 OS=Gillichthys mirabilis GN=rps13 PE=2 SV=3 1 151 2.0E-81
sp|Q962R6|RS13_SPOFR 40S ribosomal protein S13 OS=Spodoptera frugiperda GN=RpS13 PE=2 SV=3 1 151 4.0E-81
sp|Q69UI1|RS132_ORYSJ 40S ribosomal protein S13-2 OS=Oryza sativa subsp. japonica GN=Os08g0117300 PE=1 SV=1 1 151 2.0E-80
sp|Q8I7U0|RS13_PLUXY 40S ribosomal protein S13 OS=Plutella xylostella GN=RpS13 PE=2 SV=3 1 151 6.0E-80
sp|Q69UI2|RS131_ORYSJ 40S ribosomal protein S13-1 OS=Oryza sativa subsp. japonica GN=Os08g0117200 PE=3 SV=2 1 151 8.0E-80
sp|Q8MUR2|RS13_CHOPR 40S ribosomal protein S13 OS=Choristoneura parallela GN=RpS13 PE=2 SV=3 1 151 9.0E-80
sp|Q8I7D6|RS13_CIOIN 40S ribosomal protein S13 OS=Ciona intestinalis GN=RPS13 PE=2 SV=3 1 151 3.0E-79
sp|Q05761|RS13_MAIZE 40S ribosomal protein S13 OS=Zea mays GN=RPS13 PE=2 SV=1 1 151 5.0E-79
sp|Q03334|RS13_DROME 40S ribosomal protein S13 OS=Drosophila melanogaster GN=RpS13 PE=1 SV=3 1 151 1.0E-78
sp|P62300|RS13_WUCBA 40S ribosomal protein S13 OS=Wuchereria bancrofti GN=RPS13 PE=3 SV=2 1 151 5.0E-78
sp|P62299|RS13_BRUPA 40S ribosomal protein S13 OS=Brugia pahangi GN=RPS13 PE=2 SV=2 1 151 5.0E-78
sp|P52811|RS13_ANOGA 40S ribosomal protein S13 OS=Anopheles gambiae GN=RpS13 PE=2 SV=2 1 151 1.0E-77
sp|P51404|RS13_CAEEL 40S ribosomal protein S13 OS=Caenorhabditis elegans GN=rps-13 PE=3 SV=2 1 151 5.0E-74
sp|Q54PH8|RS13_DICDI 40S ribosomal protein S13 OS=Dictyostelium discoideum GN=rps13 PE=3 SV=1 1 151 2.0E-68
sp|P27072|RS13_MUSDO 40S ribosomal protein S13 (Fragment) OS=Musca domestica GN=RpS13 PE=2 SV=1 39 151 1.0E-60
sp|P62279|RS13_PIG 40S ribosomal protein S13 (Fragment) OS=Sus scrofa GN=RPS13 PE=2 SV=2 1 107 6.0E-54
sp|A1RXJ1|RS15_THEPD 30S ribosomal protein S15 OS=Thermofilum pendens (strain Hrk 5) GN=rps15 PE=3 SV=1 6 144 7.0E-46
sp|Q5JGJ4|RS15_THEKO 30S ribosomal protein S15 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps15 PE=3 SV=1 1 150 2.0E-45
sp|P54012|RS15_METJA 30S ribosomal protein S15 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps15 PE=3 SV=2 1 150 2.0E-45
sp|Q8TV08|RS15_METKA 30S ribosomal protein S15 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps15 PE=3 SV=1 1 142 7.0E-45
sp|A6UUL9|RS15_META3 30S ribosomal protein S15 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps15 PE=3 SV=1 1 150 4.0E-43
sp|Q2FS30|RS15_METHJ 30S ribosomal protein S15 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps15 PE=3 SV=1 1 151 1.0E-40
sp|A8MCD3|RS15_CALMQ 30S ribosomal protein S15 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps15 PE=3 SV=1 9 141 3.0E-40
sp|Q0W938|RS15_METAR 30S ribosomal protein S15 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps15 PE=3 SV=1 1 151 5.0E-40
sp|Q9YCX3|RS15_AERPE 30S ribosomal protein S15 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps15 PE=3 SV=1 9 151 1.0E-39
sp|O29457|RS15_ARCFU 30S ribosomal protein S15 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps15 PE=3 SV=1 1 141 1.0E-39
sp|A6UQM4|RS15_METVS 30S ribosomal protein S15 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps15 PE=3 SV=1 1 150 4.0E-39
sp|A3DMT2|RS15_STAMF 30S ribosomal protein S15 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps15 PE=3 SV=1 9 151 5.0E-39
sp|A8AAU0|RS15_IGNH4 30S ribosomal protein S15 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps15 PE=3 SV=1 9 150 6.0E-39
sp|A1RSM4|RS15_PYRIL 30S ribosomal protein S15 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps15 PE=3 SV=1 7 149 9.0E-39
sp|Q8PVA5|RS15_METMA 30S ribosomal protein S15 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps15 PE=3 SV=1 1 151 1.0E-38
sp|Q8ZT11|RS15_PYRAE 30S ribosomal protein S15 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps15 PE=3 SV=1 7 149 3.0E-38
sp|Q8TS56|RS15_METAC 30S ribosomal protein S15 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps15 PE=3 SV=1 1 151 4.0E-38
sp|A9A4V0|RS15_NITMS 30S ribosomal protein S15 OS=Nitrosopumilus maritimus (strain SCM1) GN=rps15 PE=3 SV=1 1 147 5.0E-38
sp|Q8TZD9|RS15_PYRFU 30S ribosomal protein S15 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps15 PE=1 SV=1 1 150 2.0E-37
sp|A4WMA2|RS15_PYRAR 30S ribosomal protein S15 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps15 PE=3 SV=1 9 149 3.0E-37
sp|Q9V2K9|RS15_PYRAB 30S ribosomal protein S15 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps15 PE=3 SV=1 1 150 8.0E-37
sp|Q12TM7|RS15_METBU 30S ribosomal protein S15 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps15 PE=3 SV=1 1 151 8.0E-37
sp|Q2NIA9|RS15_METST 30S ribosomal protein S15 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps15 PE=3 SV=1 21 150 1.0E-36
sp|A3MVD1|RS15_PYRCJ 30S ribosomal protein S15 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps15 PE=3 SV=1 7 149 1.0E-36
sp|A4G0Z3|RS15_METM5 30S ribosomal protein S15 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps15 PE=3 SV=1 1 150 1.0E-36
sp|A2SQ60|RS15_METLZ 30S ribosomal protein S15 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps15 PE=3 SV=1 1 151 2.0E-36
sp|Q975N5|RS15_SULTO 30S ribosomal protein S15 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps15 PE=3 SV=1 1 151 3.0E-36
sp|Q6LWX5|RS15_METMP 30S ribosomal protein S15 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps15 PE=3 SV=1 1 150 3.0E-36
sp|A6VHG7|RS15_METM7 30S ribosomal protein S15 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps15 PE=3 SV=1 1 150 3.0E-36
sp|A2BJY6|RS15_HYPBU 30S ribosomal protein S15 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps15 PE=3 SV=1 9 151 4.0E-36
sp|O57805|RS15_PYRHO 30S ribosomal protein S15 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps15 PE=3 SV=1 1 150 5.0E-36
sp|Q980A8|RS15_SULSO 30S ribosomal protein S15 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps15 PE=3 SV=1 9 151 9.0E-36
sp|A0RTT1|RS15_CENSY 30S ribosomal protein S15 OS=Cenarchaeum symbiosum (strain A) GN=rps15 PE=3 SV=1 1 146 1.0E-35
sp|Q8SRB3|RS13_ENCCU 40S ribosomal protein S13 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS13 PE=1 SV=1 1 140 1.0E-35
sp|Q46BC9|RS15_METBF 30S ribosomal protein S15 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps15 PE=3 SV=1 1 151 7.0E-35
sp|A4YIY3|RS15_METS5 30S ribosomal protein S15 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps15 PE=3 SV=1 1 151 2.0E-34
sp|A3CSL3|RS15_METMJ 30S ribosomal protein S15 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps15 PE=3 SV=1 1 150 2.0E-34
sp|A5UMH1|RS15_METS3 30S ribosomal protein S15 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps15 PE=3 SV=1 21 150 1.0E-33
sp|O27474|RS15_METTH 30S ribosomal protein S15 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps15 PE=3 SV=1 23 150 4.0E-33
sp|Q4JAI3|RS15_SULAC 30S ribosomal protein S15 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps15 PE=3 SV=1 8 151 3.0E-32
sp|Q74MB8|RS15_NANEQ 30S ribosomal protein S15 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps15 PE=3 SV=1 1 146 5.0E-32
sp|A7IAI8|RS15_METB6 30S ribosomal protein S15 OS=Methanoregula boonei (strain 6A8) GN=rps15 PE=3 SV=1 1 151 1.0E-29
sp|Q3IQA3|RS15_NATPD 30S ribosomal protein S15 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps15 PE=3 SV=1 1 144 7.0E-28
sp|Q9HRA2|RS15_HALSA 30S ribosomal protein S15 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps15 PE=3 SV=1 1 150 7.0E-28
sp|Q9HJ42|RS15_THEAC 30S ribosomal protein S15 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps15 PE=3 SV=1 1 139 1.0E-27
sp|Q6L2H3|RS15_PICTO 30S ribosomal protein S15 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps15 PE=3 SV=1 1 142 2.0E-26
sp|Q18HQ4|RS15_HALWD 30S ribosomal protein S15 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps15 PE=3 SV=1 1 130 2.0E-26
sp|Q979D0|RS15_THEVO 30S ribosomal protein S15 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps15 PE=3 SV=1 1 139 1.0E-25
sp|P05762|RS15_HALMA 30S ribosomal protein S15 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps15 PE=1 SV=3 1 144 1.0E-24
sp|A0B5E6|RS15_METTP 30S ribosomal protein S15 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps15 PE=3 SV=1 1 151 1.0E-24
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3740
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4818
Ophiocordyceps australis map64 (Brazil) OphauB2|3931
Ophiocordyceps camponoti-floridani Ophcf2|04379
Ophiocordyceps camponoti-rufipedis Ophun1|3079 (this protein)
Ophiocordyceps kimflemingae Ophio5|3894
Ophiocordyceps subramaniannii Hirsu2|7296

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3079
MGRLHSNGKGISASAVPYSRAPPAWLKTTPDQVVEQICKLARKGATPSQIGVILRDSHGIAQVKIVTGNKILRIL
KSNGLAPEIPEDLYMLIKKAVAVRKHLERNRKDKDSKFRLILIESRIHRLARYYKTVGVLPPTWKYESATASTIV
A*
Coding >Ophun1|3079
ATGGGAAGACTTCACAGCAACGGCAAGGGAATCTCCGCTTCTGCGGTGCCCTACTCGAGAGCGCCCCCTGCGTGG
CTGAAGACGACTCCCGACCAGGTGGTCGAGCAGATCTGCAAGCTGGCCAGGAAGGGTGCTACGCCTTCGCAGATT
GGTGTTATTCTGCGGGACTCGCACGGCATTGCTCAGGTCAAGATTGTCACGGGTAACAAGATTCTGCGGATTCTC
AAGTCCAACGGCCTCGCACCCGAAATCCCCGAGGACCTCTACATGTTGATCAAGAAGGCCGTTGCTGTCCGCAAG
CACCTCGAGCGCAACCGCAAGGACAAGGACTCCAAGTTCCGCCTCATTCTCATCGAGTCGCGCATCCATCGCCTG
GCCCGGTACTACAAGACGGTGGGCGTGCTGCCTCCCACCTGGAAGTACGAGTCGGCGACCGCCAGCACCATCGTC
GCATAA
Transcript >Ophun1|3079
ATGGGAAGACTTCACAGCAACGGCAAGGGAATCTCCGCTTCTGCGGTGCCCTACTCGAGAGCGCCCCCTGCGTGG
CTGAAGACGACTCCCGACCAGGTGGTCGAGCAGATCTGCAAGCTGGCCAGGAAGGGTGCTACGCCTTCGCAGATT
GGTGTTATTCTGCGGGACTCGCACGGCATTGCTCAGGTCAAGATTGTCACGGGTAACAAGATTCTGCGGATTCTC
AAGTCCAACGGCCTCGCACCCGAAATCCCCGAGGACCTCTACATGTTGATCAAGAAGGCCGTTGCTGTCCGCAAG
CACCTCGAGCGCAACCGCAAGGACAAGGACTCCAAGTTCCGCCTCATTCTCATCGAGTCGCGCATCCATCGCCTG
GCCCGGTACTACAAGACGGTGGGCGTGCTGCCTCCCACCTGGAAGTACGAGTCGGCGACCGCCAGCACCATCGTC
GCATAA
Gene >Ophun1|3079
ATGGGAAGACTTCACAGCAACGGCAAGGGAATCTCCGCTTCTGCGGTGCCCTACTCGAGAGCGCCCCCTGCGTGG
CTGAAGACGACTCCCGACCAGGTGGTCGAGCAGATCTGCAAGCTGGCCAGGAAGGGTGCTACGCCTTCGCAGATT
GGTGTTATTCTGCGGGACTCGCACGGCATTGCTCAGGTCAAGATTGTCACGGGTATGGATGGCTCTGGGTCCAGG
GAGAGATTGGGAGAGTTGTGGTTGAGCTAATGCGGTGACAGGTAACAAGATTCTGCGGATTCTCAAGTCCAACGG
TAGAGCTCCCCGAGACTGCTGTGGATGAACGTCGCGGCGGATCTGCACGGATCGCAAGACGATTTCAACATCTAC
GCCTCTGTTCGGCCATGGCTGACAGAGTGATGATGCAGGCCTCGCACCCGAAATCCCCGAGGACCTCTACATGTT
GATCAAGAAGGTAGGCGCTCGGCTCAGAGCTCGCGGCGTGGATTCTGACTCGATGCGACTCGTCACTAGGCCGTT
GCTGTCCGCAAGCACCTCGAGCGCAACCGCAAGGACAAGGACTCCAAGTTCCGCCTCATTCTCATCGAGTCGCGC
ATCCATCGCCTGGCCCGGTACTACAAGACGGTGGGCGTGCTGCCTCCCACCTGGAAGTACGAGTCGGCGACCGCC
AGCACCATCGTCGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail