Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3076
Gene name
LocationContig_273:5658..9279
Strand-
Gene length (bp)3621
Transcript length (bp)3621
Coding sequence length (bp)3621
Protein length (aa) 1207

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08920 SF3b1 Splicing factor 3B subunit 1 1.4E-17 236 350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10178|SF3B1_SCHPO U2 snRNP component prp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp10 PE=1 SV=3 1 1191 0.0E+00
sp|Q99NB9|SF3B1_MOUSE Splicing factor 3B subunit 1 OS=Mus musculus GN=Sf3b1 PE=1 SV=1 215 1190 0.0E+00
sp|O75533|SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 215 1190 0.0E+00
sp|O57683|SF3B1_XENLA Splicing factor 3B subunit 1 OS=Xenopus laevis GN=sf3b1 PE=2 SV=1 215 1190 0.0E+00
sp|P49955|SF3B1_YEAST U2 snRNP component HSH155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSH155 PE=1 SV=1 363 1190 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10178|SF3B1_SCHPO U2 snRNP component prp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp10 PE=1 SV=3 1 1191 0.0E+00
sp|Q99NB9|SF3B1_MOUSE Splicing factor 3B subunit 1 OS=Mus musculus GN=Sf3b1 PE=1 SV=1 215 1190 0.0E+00
sp|O75533|SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 215 1190 0.0E+00
sp|O57683|SF3B1_XENLA Splicing factor 3B subunit 1 OS=Xenopus laevis GN=sf3b1 PE=2 SV=1 215 1190 0.0E+00
sp|P49955|SF3B1_YEAST U2 snRNP component HSH155 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSH155 PE=1 SV=1 363 1190 0.0E+00
sp|O57683|SF3B1_XENLA Splicing factor 3B subunit 1 OS=Xenopus laevis GN=sf3b1 PE=2 SV=1 46 278 3.0E-12
sp|Q99NB9|SF3B1_MOUSE Splicing factor 3B subunit 1 OS=Mus musculus GN=Sf3b1 PE=1 SV=1 22 298 2.0E-10
sp|O75533|SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 22 298 2.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3737
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4821
Ophiocordyceps australis map64 (Brazil) OphauB2|3934
Ophiocordyceps camponoti-floridani Ophcf2|04376
Ophiocordyceps camponoti-rufipedis Ophun1|3076 (this protein)
Ophiocordyceps kimflemingae Ophio5|3897
Ophiocordyceps subramaniannii Hirsu2|7292

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3076
MSDADFEAVARLQRERNAAAAGKKNSHDASNQRGDSKRQKLTENADSDLYEKDGDKFAGYHQSLPMGDDDDDAAE
DRTVRLTGQYTASRDMIDEFARGEGVEEDDVLAGRGEKSGRIIDRESDYQKRRFNRVLTPTRADPFAENRQAGAA
EKGTTYREIMQSNELDREEDRVRRAIQAKQKDEANVEHAKPTLQNTDKENSDAGSTELVTAGRKRKKRWDISSTP
ADDQSQSEAAPPKRSRWDEAPSVSSEPQRQRSRWDQAPSATPMGNSGLSTPAQPTKVLSLPTTFGTDIGRNMPLT
DEELDMLLPGEDQGYKILEFPAGFVQARVPSHRSMAMPPPPTGFIMQDPDQVRLGGQPMPTEISGVGDLQFLKPE
DMTYFGKLNDGVDESTMSVDELKERKIMKLLLKIKNGTPPMRKTALRQITDNARQFGPGPLFAQILPLLMEKTLE
EQERHLLVKVIDRILYKLDDLVRPFVHKILVVIEPLLIDQDYYARVEGREIISNVAKAAGLATMISVMRPDIDHV
DDYVRNTTARAFAVVASALSIPALLPFLGAVCRSKKSWHARHTGVKIVQQIAILMGCAVLPHLKGLVECIANNLN
DDQTKVRTVTSLAIAALAEASNPYGIESFDEILNPLWTGARKQRGKGLAGFLKAVGYIIPLMDEEYANYYTTQIM
EILLREFSSPDEEMKKVVLKVVSQCAATKGVSGNYLKEHVLDDFFKNFWVKRMALDKRNYKQVVETTVDIGQKVG
VSEMLERIVDNLKDESEAYRKMTVETMEKVVTSLGAADIDDRLEERLVDGILYTFQEQSVEDIVILNGFGSVVNA
LGDRCGPFLPQITSTILWRLNHKSPTVRQQAADLISRIAMVMKQCGEDELMGKLGVVLYEYLGEEYPEVLGSMLG
ALRSIVTVVGIAQMQPPIKDLLPRLTPILRNRHEKVQENTIDLVGRIADRGPESVNAREWMRICFELLDMLKAHK
KGIRRAANNTFGFIAKAIGPQDVLATLLSNLRVQERQSRVNTAVAIGIVAETCAPFTVLPALMNEYRVPELNVQN
GVLKALSFLFEYIGEMGKDYVYAVTPLLEDALIDRDQVHRQTAASVVKHIGLGVIGLGCEDAMVHLLNLLYPNLF
ETSPHVIDRIIEAIEAIRMAVGPGAVLNYVWAGLFHPARKVRTPYWRLFNDAYVQGADAMVPYYPNWCEEGLDRP
ELGVML*
Coding >Ophun1|3076
ATGTCGGACGCCGACTTTGAGGCGGTGGCCAGGCTGCAGCGGGAGCGTAACGCTGCGGCGGCTGGGAAGAAAAAC
TCGCACGACGCCTCGAACCAACGCGGCGATTCGAAACGCCAGAAGCTCACAGAAAACGCCGACAGCGATCTGTAC
GAAAAGGATGGCGATAAGTTTGCAGGCTATCACCAGTCTCTCCCGATGGGCGATGACGACGACGATGCTGCCGAG
GACCGCACCGTCCGTCTGACTGGCCAGTACACGGCCTCTCGAGACATGATCGACGAGTTTGCCCGAGGCGAAGGA
GTGGAAGAAGATGACGTCCTTGCCGGACGAGGAGAGAAGAGCGGCCGGATCATCGACCGCGAGAGCGACTACCAG
AAGCGTCGTTTCAACCGCGTCCTGACGCCCACCAGAGCCGATCCCTTTGCCGAGAATCGCCAGGCTGGCGCGGCG
GAAAAGGGTACAACGTATCGCGAGATTATGCAGAGCAATGAACTCGACAGAGAGGAAGATCGCGTTCGACGAGCC
ATTCAAGCCAAGCAGAAGGACGAGGCAAACGTCGAGCACGCCAAGCCCACGCTCCAAAACACGGACAAGGAAAAC
TCCGATGCCGGTTCGACGGAGCTGGTGACGGCGGGTCGCAAGCGAAAGAAGAGATGGGACATTTCGTCGACGCCG
GCCGATGACCAGTCGCAGTCGGAGGCTGCGCCGCCGAAGCGCTCCCGATGGGACGAAGCACCGTCCGTGTCATCG
GAGCCACAGAGACAGCGCTCCCGCTGGGACCAGGCCCCATCGGCGACGCCCATGGGCAACTCCGGGCTCTCGACC
CCCGCGCAGCCGACAAAGGTTCTCTCGTTGCCGACGACGTTTGGCACCGATATTGGACGAAACATGCCGCTGACG
GACGAGGAGCTCGACATGCTGCTACCCGGCGAGGACCAGGGCTACAAAATTCTCGAATTCCCTGCCGGCTTCGTC
CAGGCGCGCGTCCCGTCGCATAGGTCGATGGCGATGCCCCCTCCGCCGACGGGCTTCATCATGCAGGACCCCGAT
CAAGTGCGGCTGGGCGGCCAACCCATGCCGACGGAGATCTCGGGAGTCGGAGACTTGCAGTTCCTCAAACCCGAG
GACATGACGTATTTCGGAAAGCTCAACGACGGCGTCGACGAGAGCACCATGTCGGTCGACGAGCTCAAGGAGAGA
AAGATTATGAAGCTACTGCTCAAGATCAAGAACGGAACGCCACCCATGCGCAAGACTGCTCTTCGGCAAATCACG
GACAACGCGAGGCAGTTTGGACCGGGCCCCTTGTTCGCGCAGATCCTCCCGCTGCTGATGGAGAAGACGCTGGAG
GAGCAGGAACGCCATCTCCTGGTCAAGGTCATCGACCGCATTCTGTACAAGCTCGACGACCTCGTGCGGCCGTTT
GTGCACAAGATCCTGGTGGTCATCGAGCCGCTCCTCATCGACCAGGATTACTACGCCCGGGTCGAGGGCCGAGAG
ATCATCTCCAACGTGGCCAAGGCGGCCGGGCTCGCGACCATGATTAGCGTGATGCGACCCGATATCGACCACGTC
GACGACTACGTGCGAAACACTACAGCCAGAGCGTTTGCGGTGGTGGCATCGGCCCTCTCGATCCCGGCTCTGCTC
CCGTTCCTGGGCGCGGTATGCCGCAGCAAGAAGTCGTGGCACGCGCGCCACACGGGGGTCAAGATTGTGCAGCAG
ATTGCCATCCTGATGGGATGCGCCGTGCTGCCACACCTCAAGGGCCTGGTGGAGTGCATCGCCAACAACCTCAAC
GACGACCAGACCAAGGTGCGGACGGTGACCAGTCTCGCTATTGCCGCACTGGCCGAGGCGTCCAACCCTTATGGT
ATCGAGAGCTTCGACGAGATCCTGAACCCGCTGTGGACGGGAGCGCGCAAGCAGAGAGGCAAGGGCCTGGCCGGG
TTCCTCAAGGCCGTGGGATACATCATCCCGCTCATGGACGAGGAGTACGCCAACTACTACACGACTCAGATCATG
GAGATTCTGCTGCGCGAGTTCTCGTCGCCGGACGAGGAGATGAAGAAGGTGGTGCTCAAGGTGGTGTCGCAGTGC
GCGGCGACAAAGGGCGTGAGCGGCAACTATCTCAAGGAACACGTGCTGGACGACTTCTTCAAGAACTTTTGGGTC
AAGCGGATGGCGCTGGACAAGCGCAACTACAAGCAGGTGGTGGAGACGACGGTGGACATTGGACAGAAGGTGGGC
GTGAGCGAGATGCTGGAGCGCATCGTGGACAACCTCAAGGACGAGAGCGAGGCGTACCGCAAGATGACGGTCGAG
ACGATGGAGAAGGTGGTGACGAGCCTGGGAGCGGCCGACATCGACGACCGGCTGGAGGAGCGGCTGGTGGACGGG
ATCCTGTACACGTTCCAGGAGCAGAGCGTCGAGGACATTGTCATACTCAACGGGTTCGGATCGGTGGTGAACGCG
CTGGGCGACCGGTGCGGACCGTTCCTACCGCAGATTACGAGCACGATCCTCTGGCGGCTCAACCACAAGTCGCCG
ACGGTACGACAGCAGGCGGCGGACCTCATCTCGCGGATCGCCATGGTGATGAAGCAGTGCGGCGAGGACGAGCTG
ATGGGCAAGCTCGGCGTCGTCCTCTACGAGTACCTGGGCGAGGAGTATCCCGAGGTGCTGGGATCGATGCTGGGG
GCGCTGCGGTCCATCGTGACGGTGGTGGGCATCGCGCAGATGCAGCCGCCCATCAAGGACCTGCTGCCCCGGCTG
ACGCCCATCCTCCGCAACCGGCACGAGAAGGTGCAGGAGAACACGATCGACCTGGTGGGACGGATCGCGGACAGG
GGGCCGGAGAGCGTCAACGCGCGCGAGTGGATGCGCATCTGCTTCGAGCTGCTGGACATGCTCAAGGCCCACAAG
AAGGGGATCCGACGAGCGGCCAACAACACGTTTGGCTTCATCGCAAAGGCCATCGGGCCGCAGGACGTGCTGGCG
ACGCTGCTGAGCAACCTCCGGGTGCAGGAGCGTCAGTCGCGGGTCAACACGGCGGTGGCGATTGGCATCGTGGCG
GAGACGTGCGCGCCCTTTACGGTGCTGCCGGCGCTGATGAACGAGTACCGGGTGCCGGAGCTCAACGTGCAGAAC
GGGGTGCTCAAGGCGCTGTCGTTCCTGTTCGAGTACATTGGCGAGATGGGCAAGGACTACGTGTACGCGGTGACG
CCGCTGCTGGAGGACGCGCTCATCGACCGGGACCAGGTGCACCGGCAGACGGCGGCGTCGGTGGTGAAGCACATT
GGGCTGGGCGTCATCGGGCTGGGGTGCGAGGACGCCATGGTTCACCTGCTGAACCTGCTGTACCCGAACCTGTTT
GAGACGAGCCCGCACGTCATCGACCGCATCATCGAGGCCATCGAGGCCATACGGATGGCCGTGGGGCCGGGCGCG
GTGCTCAACTACGTGTGGGCCGGGCTGTTCCATCCGGCTCGAAAGGTGCGGACGCCGTACTGGCGGTTGTTCAAC
GACGCGTACGTGCAGGGGGCGGACGCCATGGTGCCCTATTATCCGAACTGGTGCGAGGAGGGGCTGGACAGGCCG
GAGCTGGGCGTGATGCTATAG
Transcript >Ophun1|3076
ATGTCGGACGCCGACTTTGAGGCGGTGGCCAGGCTGCAGCGGGAGCGTAACGCTGCGGCGGCTGGGAAGAAAAAC
TCGCACGACGCCTCGAACCAACGCGGCGATTCGAAACGCCAGAAGCTCACAGAAAACGCCGACAGCGATCTGTAC
GAAAAGGATGGCGATAAGTTTGCAGGCTATCACCAGTCTCTCCCGATGGGCGATGACGACGACGATGCTGCCGAG
GACCGCACCGTCCGTCTGACTGGCCAGTACACGGCCTCTCGAGACATGATCGACGAGTTTGCCCGAGGCGAAGGA
GTGGAAGAAGATGACGTCCTTGCCGGACGAGGAGAGAAGAGCGGCCGGATCATCGACCGCGAGAGCGACTACCAG
AAGCGTCGTTTCAACCGCGTCCTGACGCCCACCAGAGCCGATCCCTTTGCCGAGAATCGCCAGGCTGGCGCGGCG
GAAAAGGGTACAACGTATCGCGAGATTATGCAGAGCAATGAACTCGACAGAGAGGAAGATCGCGTTCGACGAGCC
ATTCAAGCCAAGCAGAAGGACGAGGCAAACGTCGAGCACGCCAAGCCCACGCTCCAAAACACGGACAAGGAAAAC
TCCGATGCCGGTTCGACGGAGCTGGTGACGGCGGGTCGCAAGCGAAAGAAGAGATGGGACATTTCGTCGACGCCG
GCCGATGACCAGTCGCAGTCGGAGGCTGCGCCGCCGAAGCGCTCCCGATGGGACGAAGCACCGTCCGTGTCATCG
GAGCCACAGAGACAGCGCTCCCGCTGGGACCAGGCCCCATCGGCGACGCCCATGGGCAACTCCGGGCTCTCGACC
CCCGCGCAGCCGACAAAGGTTCTCTCGTTGCCGACGACGTTTGGCACCGATATTGGACGAAACATGCCGCTGACG
GACGAGGAGCTCGACATGCTGCTACCCGGCGAGGACCAGGGCTACAAAATTCTCGAATTCCCTGCCGGCTTCGTC
CAGGCGCGCGTCCCGTCGCATAGGTCGATGGCGATGCCCCCTCCGCCGACGGGCTTCATCATGCAGGACCCCGAT
CAAGTGCGGCTGGGCGGCCAACCCATGCCGACGGAGATCTCGGGAGTCGGAGACTTGCAGTTCCTCAAACCCGAG
GACATGACGTATTTCGGAAAGCTCAACGACGGCGTCGACGAGAGCACCATGTCGGTCGACGAGCTCAAGGAGAGA
AAGATTATGAAGCTACTGCTCAAGATCAAGAACGGAACGCCACCCATGCGCAAGACTGCTCTTCGGCAAATCACG
GACAACGCGAGGCAGTTTGGACCGGGCCCCTTGTTCGCGCAGATCCTCCCGCTGCTGATGGAGAAGACGCTGGAG
GAGCAGGAACGCCATCTCCTGGTCAAGGTCATCGACCGCATTCTGTACAAGCTCGACGACCTCGTGCGGCCGTTT
GTGCACAAGATCCTGGTGGTCATCGAGCCGCTCCTCATCGACCAGGATTACTACGCCCGGGTCGAGGGCCGAGAG
ATCATCTCCAACGTGGCCAAGGCGGCCGGGCTCGCGACCATGATTAGCGTGATGCGACCCGATATCGACCACGTC
GACGACTACGTGCGAAACACTACAGCCAGAGCGTTTGCGGTGGTGGCATCGGCCCTCTCGATCCCGGCTCTGCTC
CCGTTCCTGGGCGCGGTATGCCGCAGCAAGAAGTCGTGGCACGCGCGCCACACGGGGGTCAAGATTGTGCAGCAG
ATTGCCATCCTGATGGGATGCGCCGTGCTGCCACACCTCAAGGGCCTGGTGGAGTGCATCGCCAACAACCTCAAC
GACGACCAGACCAAGGTGCGGACGGTGACCAGTCTCGCTATTGCCGCACTGGCCGAGGCGTCCAACCCTTATGGT
ATCGAGAGCTTCGACGAGATCCTGAACCCGCTGTGGACGGGAGCGCGCAAGCAGAGAGGCAAGGGCCTGGCCGGG
TTCCTCAAGGCCGTGGGATACATCATCCCGCTCATGGACGAGGAGTACGCCAACTACTACACGACTCAGATCATG
GAGATTCTGCTGCGCGAGTTCTCGTCGCCGGACGAGGAGATGAAGAAGGTGGTGCTCAAGGTGGTGTCGCAGTGC
GCGGCGACAAAGGGCGTGAGCGGCAACTATCTCAAGGAACACGTGCTGGACGACTTCTTCAAGAACTTTTGGGTC
AAGCGGATGGCGCTGGACAAGCGCAACTACAAGCAGGTGGTGGAGACGACGGTGGACATTGGACAGAAGGTGGGC
GTGAGCGAGATGCTGGAGCGCATCGTGGACAACCTCAAGGACGAGAGCGAGGCGTACCGCAAGATGACGGTCGAG
ACGATGGAGAAGGTGGTGACGAGCCTGGGAGCGGCCGACATCGACGACCGGCTGGAGGAGCGGCTGGTGGACGGG
ATCCTGTACACGTTCCAGGAGCAGAGCGTCGAGGACATTGTCATACTCAACGGGTTCGGATCGGTGGTGAACGCG
CTGGGCGACCGGTGCGGACCGTTCCTACCGCAGATTACGAGCACGATCCTCTGGCGGCTCAACCACAAGTCGCCG
ACGGTACGACAGCAGGCGGCGGACCTCATCTCGCGGATCGCCATGGTGATGAAGCAGTGCGGCGAGGACGAGCTG
ATGGGCAAGCTCGGCGTCGTCCTCTACGAGTACCTGGGCGAGGAGTATCCCGAGGTGCTGGGATCGATGCTGGGG
GCGCTGCGGTCCATCGTGACGGTGGTGGGCATCGCGCAGATGCAGCCGCCCATCAAGGACCTGCTGCCCCGGCTG
ACGCCCATCCTCCGCAACCGGCACGAGAAGGTGCAGGAGAACACGATCGACCTGGTGGGACGGATCGCGGACAGG
GGGCCGGAGAGCGTCAACGCGCGCGAGTGGATGCGCATCTGCTTCGAGCTGCTGGACATGCTCAAGGCCCACAAG
AAGGGGATCCGACGAGCGGCCAACAACACGTTTGGCTTCATCGCAAAGGCCATCGGGCCGCAGGACGTGCTGGCG
ACGCTGCTGAGCAACCTCCGGGTGCAGGAGCGTCAGTCGCGGGTCAACACGGCGGTGGCGATTGGCATCGTGGCG
GAGACGTGCGCGCCCTTTACGGTGCTGCCGGCGCTGATGAACGAGTACCGGGTGCCGGAGCTCAACGTGCAGAAC
GGGGTGCTCAAGGCGCTGTCGTTCCTGTTCGAGTACATTGGCGAGATGGGCAAGGACTACGTGTACGCGGTGACG
CCGCTGCTGGAGGACGCGCTCATCGACCGGGACCAGGTGCACCGGCAGACGGCGGCGTCGGTGGTGAAGCACATT
GGGCTGGGCGTCATCGGGCTGGGGTGCGAGGACGCCATGGTTCACCTGCTGAACCTGCTGTACCCGAACCTGTTT
GAGACGAGCCCGCACGTCATCGACCGCATCATCGAGGCCATCGAGGCCATACGGATGGCCGTGGGGCCGGGCGCG
GTGCTCAACTACGTGTGGGCCGGGCTGTTCCATCCGGCTCGAAAGGTGCGGACGCCGTACTGGCGGTTGTTCAAC
GACGCGTACGTGCAGGGGGCGGACGCCATGGTGCCCTATTATCCGAACTGGTGCGAGGAGGGGCTGGACAGGCCG
GAGCTGGGCGTGATGCTATAG
Gene >Ophun1|3076
ATGTCGGACGCCGACTTTGAGGCGGTGGCCAGGCTGCAGCGGGAGCGTAACGCTGCGGCGGCTGGGAAGAAAAAC
TCGCACGACGCCTCGAACCAACGCGGCGATTCGAAACGCCAGAAGCTCACAGAAAACGCCGACAGCGATCTGTAC
GAAAAGGATGGCGATAAGTTTGCAGGCTATCACCAGTCTCTCCCGATGGGCGATGACGACGACGATGCTGCCGAG
GACCGCACCGTCCGTCTGACTGGCCAGTACACGGCCTCTCGAGACATGATCGACGAGTTTGCCCGAGGCGAAGGA
GTGGAAGAAGATGACGTCCTTGCCGGACGAGGAGAGAAGAGCGGCCGGATCATCGACCGCGAGAGCGACTACCAG
AAGCGTCGTTTCAACCGCGTCCTGACGCCCACCAGAGCCGATCCCTTTGCCGAGAATCGCCAGGCTGGCGCGGCG
GAAAAGGGTACAACGTATCGCGAGATTATGCAGAGCAATGAACTCGACAGAGAGGAAGATCGCGTTCGACGAGCC
ATTCAAGCCAAGCAGAAGGACGAGGCAAACGTCGAGCACGCCAAGCCCACGCTCCAAAACACGGACAAGGAAAAC
TCCGATGCCGGTTCGACGGAGCTGGTGACGGCGGGTCGCAAGCGAAAGAAGAGATGGGACATTTCGTCGACGCCG
GCCGATGACCAGTCGCAGTCGGAGGCTGCGCCGCCGAAGCGCTCCCGATGGGACGAAGCACCGTCCGTGTCATCG
GAGCCACAGAGACAGCGCTCCCGCTGGGACCAGGCCCCATCGGCGACGCCCATGGGCAACTCCGGGCTCTCGACC
CCCGCGCAGCCGACAAAGGTTCTCTCGTTGCCGACGACGTTTGGCACCGATATTGGACGAAACATGCCGCTGACG
GACGAGGAGCTCGACATGCTGCTACCCGGCGAGGACCAGGGCTACAAAATTCTCGAATTCCCTGCCGGCTTCGTC
CAGGCGCGCGTCCCGTCGCATAGGTCGATGGCGATGCCCCCTCCGCCGACGGGCTTCATCATGCAGGACCCCGAT
CAAGTGCGGCTGGGCGGCCAACCCATGCCGACGGAGATCTCGGGAGTCGGAGACTTGCAGTTCCTCAAACCCGAG
GACATGACGTATTTCGGAAAGCTCAACGACGGCGTCGACGAGAGCACCATGTCGGTCGACGAGCTCAAGGAGAGA
AAGATTATGAAGCTACTGCTCAAGATCAAGAACGGAACGCCACCCATGCGCAAGACTGCTCTTCGGCAAATCACG
GACAACGCGAGGCAGTTTGGACCGGGCCCCTTGTTCGCGCAGATCCTCCCGCTGCTGATGGAGAAGACGCTGGAG
GAGCAGGAACGCCATCTCCTGGTCAAGGTCATCGACCGCATTCTGTACAAGCTCGACGACCTCGTGCGGCCGTTT
GTGCACAAGATCCTGGTGGTCATCGAGCCGCTCCTCATCGACCAGGATTACTACGCCCGGGTCGAGGGCCGAGAG
ATCATCTCCAACGTGGCCAAGGCGGCCGGGCTCGCGACCATGATTAGCGTGATGCGACCCGATATCGACCACGTC
GACGACTACGTGCGAAACACTACAGCCAGAGCGTTTGCGGTGGTGGCATCGGCCCTCTCGATCCCGGCTCTGCTC
CCGTTCCTGGGCGCGGTATGCCGCAGCAAGAAGTCGTGGCACGCGCGCCACACGGGGGTCAAGATTGTGCAGCAG
ATTGCCATCCTGATGGGATGCGCCGTGCTGCCACACCTCAAGGGCCTGGTGGAGTGCATCGCCAACAACCTCAAC
GACGACCAGACCAAGGTGCGGACGGTGACCAGTCTCGCTATTGCCGCACTGGCCGAGGCGTCCAACCCTTATGGT
ATCGAGAGCTTCGACGAGATCCTGAACCCGCTGTGGACGGGAGCGCGCAAGCAGAGAGGCAAGGGCCTGGCCGGG
TTCCTCAAGGCCGTGGGATACATCATCCCGCTCATGGACGAGGAGTACGCCAACTACTACACGACTCAGATCATG
GAGATTCTGCTGCGCGAGTTCTCGTCGCCGGACGAGGAGATGAAGAAGGTGGTGCTCAAGGTGGTGTCGCAGTGC
GCGGCGACAAAGGGCGTGAGCGGCAACTATCTCAAGGAACACGTGCTGGACGACTTCTTCAAGAACTTTTGGGTC
AAGCGGATGGCGCTGGACAAGCGCAACTACAAGCAGGTGGTGGAGACGACGGTGGACATTGGACAGAAGGTGGGC
GTGAGCGAGATGCTGGAGCGCATCGTGGACAACCTCAAGGACGAGAGCGAGGCGTACCGCAAGATGACGGTCGAG
ACGATGGAGAAGGTGGTGACGAGCCTGGGAGCGGCCGACATCGACGACCGGCTGGAGGAGCGGCTGGTGGACGGG
ATCCTGTACACGTTCCAGGAGCAGAGCGTCGAGGACATTGTCATACTCAACGGGTTCGGATCGGTGGTGAACGCG
CTGGGCGACCGGTGCGGACCGTTCCTACCGCAGATTACGAGCACGATCCTCTGGCGGCTCAACCACAAGTCGCCG
ACGGTACGACAGCAGGCGGCGGACCTCATCTCGCGGATCGCCATGGTGATGAAGCAGTGCGGCGAGGACGAGCTG
ATGGGCAAGCTCGGCGTCGTCCTCTACGAGTACCTGGGCGAGGAGTATCCCGAGGTGCTGGGATCGATGCTGGGG
GCGCTGCGGTCCATCGTGACGGTGGTGGGCATCGCGCAGATGCAGCCGCCCATCAAGGACCTGCTGCCCCGGCTG
ACGCCCATCCTCCGCAACCGGCACGAGAAGGTGCAGGAGAACACGATCGACCTGGTGGGACGGATCGCGGACAGG
GGGCCGGAGAGCGTCAACGCGCGCGAGTGGATGCGCATCTGCTTCGAGCTGCTGGACATGCTCAAGGCCCACAAG
AAGGGGATCCGACGAGCGGCCAACAACACGTTTGGCTTCATCGCAAAGGCCATCGGGCCGCAGGACGTGCTGGCG
ACGCTGCTGAGCAACCTCCGGGTGCAGGAGCGTCAGTCGCGGGTCAACACGGCGGTGGCGATTGGCATCGTGGCG
GAGACGTGCGCGCCCTTTACGGTGCTGCCGGCGCTGATGAACGAGTACCGGGTGCCGGAGCTCAACGTGCAGAAC
GGGGTGCTCAAGGCGCTGTCGTTCCTGTTCGAGTACATTGGCGAGATGGGCAAGGACTACGTGTACGCGGTGACG
CCGCTGCTGGAGGACGCGCTCATCGACCGGGACCAGGTGCACCGGCAGACGGCGGCGTCGGTGGTGAAGCACATT
GGGCTGGGCGTCATCGGGCTGGGGTGCGAGGACGCCATGGTTCACCTGCTGAACCTGCTGTACCCGAACCTGTTT
GAGACGAGCCCGCACGTCATCGACCGCATCATCGAGGCCATCGAGGCCATACGGATGGCCGTGGGGCCGGGCGCG
GTGCTCAACTACGTGTGGGCCGGGCTGTTCCATCCGGCTCGAAAGGTGCGGACGCCGTACTGGCGGTTGTTCAAC
GACGCGTACGTGCAGGGGGCGGACGCCATGGTGCCCTATTATCCGAACTGGTGCGAGGAGGGGCTGGACAGGCCG
GAGCTGGGCGTGATGCTATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail