Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3071
Gene name
LocationContig_272:12831..13827
Strand-
Gene length (bp)996
Transcript length (bp)996
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02089 Palm_thioest Palmitoyl protein thioesterase 2.2E-84 49 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 27 320 9.0E-55
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 27 320 8.0E-54
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 46 319 4.0E-53
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 47 309 1.0E-52
sp|P45479|PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1 46 319 2.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 27 320 9.0E-55
sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 27 320 8.0E-54
sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=1 SV=2 46 319 4.0E-53
sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 47 309 1.0E-52
sp|P45479|PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1 46 319 2.0E-52
sp|Q20390|PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2 41 319 8.0E-52
sp|Q9W3C7|PPT1_DROME Palmitoyl-protein thioesterase 1 OS=Drosophila melanogaster GN=Ppt1 PE=1 SV=2 43 308 8.0E-42
sp|O59747|PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdf1 PE=1 SV=2 44 306 9.0E-41
sp|Q54CM0|PPT3_DICDI Palmitoyl-protein thioesterase 3 OS=Dictyostelium discoideum GN=ppt3 PE=3 SV=1 49 307 6.0E-37
sp|Q6PCJ9|PPT2A_XENLA Lysosomal thioesterase PPT2-A OS=Xenopus laevis GN=ppt2-a PE=2 SV=1 34 301 2.0E-15
sp|Q6GNY7|PPT2B_XENLA Lysosomal thioesterase PPT2-B OS=Xenopus laevis GN=ppt2-b PE=2 SV=1 49 301 6.0E-15
sp|Q9UMR5|PPT2_HUMAN Lysosomal thioesterase PPT2 OS=Homo sapiens GN=PPT2 PE=1 SV=4 49 294 2.0E-14
sp|O70489|PPT2_RAT Lysosomal thioesterase PPT2 OS=Rattus norvegicus GN=Ppt2 PE=2 SV=1 49 294 1.0E-13
sp|Q9VKH6|PPT2_DROME Lysosomal thioesterase PPT2 homolog OS=Drosophila melanogaster GN=Ppt2 PE=2 SV=1 49 303 2.0E-13
sp|Q1JQA0|PPT2_BOVIN Lysosomal thioesterase PPT2 OS=Bos taurus GN=PPT2 PE=2 SV=1 49 294 4.0E-13
sp|O35448|PPT2_MOUSE Lysosomal thioesterase PPT2 OS=Mus musculus GN=Ppt2 PE=1 SV=1 49 294 2.0E-12
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.99948

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5962
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4395
Ophiocordyceps australis map64 (Brazil) OphauB2|8100
Ophiocordyceps camponoti-floridani Ophcf2|06276
Ophiocordyceps camponoti-rufipedis Ophun1|3071 (this protein)
Ophiocordyceps kimflemingae Ophio5|1728

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3071
MAPRPPLLLVALFTLSTCTPSPPPQPAIIPLSPAAKHPQAYTSSSNPLPLLIWHGLGDTFSSPGIEEIASLASTI
HPGTLVYTISLGGSDARADRSATFFGNVSAQLSDVCDAIAAHPILATAPAVDALGLSQGGQFMRGFVERCNVPPV
RSLVTFGSQHNGIAQFKQCEPTDWLCGAAMLLLKHNTWSHLVQSRLVPAQYFRDPADYESYLDNSNFLADINNER
PIKNETYRANLARLANFVLYMFDHDETVIPKETSWFAEVNGSKVVPLRERRIYTEDWLGLRRLDEKGALHFRTIP
GGHMDIPRQLLNDTMAEFFGPLRESILSDEL*
Coding >Ophun1|3071
ATGGCGCCGCGACCGCCCCTCCTCCTCGTCGCCCTCTTCACTCTATCAACCTGCACGCCCTCACCACCACCCCAA
CCAGCAATCATCCCCCTAAGCCCCGCCGCCAAACATCCCCAAGCATACACCTCGTCCTCCAATCCCCTCCCTCTC
CTCATCTGGCACGGCCTAGGCGACACCTTCTCCAGCCCCGGCATCGAAGAAATCGCCTCCCTCGCATCAACCATC
CACCCGGGAACCCTCGTCTACACCATCAGCCTGGGAGGTTCCGACGCCCGAGCCGACCGCTCGGCGACGTTCTTC
GGTAACGTCTCCGCCCAGCTTTCTGACGTCTGCGATGCCATCGCCGCGCATCCCATACTAGCCACCGCCCCGGCC
GTCGACGCCCTCGGTCTGTCGCAAGGGGGCCAGTTCATGCGCGGCTTCGTCGAGCGCTGCAACGTACCGCCCGTT
CGAAGCCTCGTCACGTTCGGAAGCCAGCATAACGGTATTGCGCAGTTTAAGCAGTGTGAGCCGACGGATTGGCTA
TGCGGTGCCGCCATGTTGCTGCTCAAGCATAATACCTGGAGCCATCTCGTTCAGAGCCGTCTCGTGCCCGCCCAG
TACTTCCGCGACCCGGCTGATTACGAGTCCTACCTCGACAACTCCAACTTTCTAGCCGACATCAACAACGAACGT
CCCATCAAGAACGAAACGTACCGCGCCAACCTAGCCCGTCTCGCCAACTTCGTCCTCTACATGTTCGACCACGAC
GAGACCGTCATCCCCAAGGAGACGTCTTGGTTCGCTGAAGTCAACGGCTCCAAGGTGGTGCCCCTGCGCGAGCGT
CGCATCTACACTGAGGATTGGCTGGGTCTGCGCCGTCTGGATGAAAAGGGCGCGCTGCACTTTAGGACCATTCCC
GGCGGCCATATGGATATCCCGCGCCAGTTGCTCAACGATACCATGGCTGAGTTCTTTGGGCCTCTGCGCGAGTCT
ATCTTGTCCGACGAGTTGTAA
Transcript >Ophun1|3071
ATGGCGCCGCGACCGCCCCTCCTCCTCGTCGCCCTCTTCACTCTATCAACCTGCACGCCCTCACCACCACCCCAA
CCAGCAATCATCCCCCTAAGCCCCGCCGCCAAACATCCCCAAGCATACACCTCGTCCTCCAATCCCCTCCCTCTC
CTCATCTGGCACGGCCTAGGCGACACCTTCTCCAGCCCCGGCATCGAAGAAATCGCCTCCCTCGCATCAACCATC
CACCCGGGAACCCTCGTCTACACCATCAGCCTGGGAGGTTCCGACGCCCGAGCCGACCGCTCGGCGACGTTCTTC
GGTAACGTCTCCGCCCAGCTTTCTGACGTCTGCGATGCCATCGCCGCGCATCCCATACTAGCCACCGCCCCGGCC
GTCGACGCCCTCGGTCTGTCGCAAGGGGGCCAGTTCATGCGCGGCTTCGTCGAGCGCTGCAACGTACCGCCCGTT
CGAAGCCTCGTCACGTTCGGAAGCCAGCATAACGGTATTGCGCAGTTTAAGCAGTGTGAGCCGACGGATTGGCTA
TGCGGTGCCGCCATGTTGCTGCTCAAGCATAATACCTGGAGCCATCTCGTTCAGAGCCGTCTCGTGCCCGCCCAG
TACTTCCGCGACCCGGCTGATTACGAGTCCTACCTCGACAACTCCAACTTTCTAGCCGACATCAACAACGAACGT
CCCATCAAGAACGAAACGTACCGCGCCAACCTAGCCCGTCTCGCCAACTTCGTCCTCTACATGTTCGACCACGAC
GAGACCGTCATCCCCAAGGAGACGTCTTGGTTCGCTGAAGTCAACGGCTCCAAGGTGGTGCCCCTGCGCGAGCGT
CGCATCTACACTGAGGATTGGCTGGGTCTGCGCCGTCTGGATGAAAAGGGCGCGCTGCACTTTAGGACCATTCCC
GGCGGCCATATGGATATCCCGCGCCAGTTGCTCAACGATACCATGGCTGAGTTCTTTGGGCCTCTGCGCGAGTCT
ATCTTGTCCGACGAGTTGTAA
Gene >Ophun1|3071
ATGGCGCCGCGACCGCCCCTCCTCCTCGTCGCCCTCTTCACTCTATCAACCTGCACGCCCTCACCACCACCCCAA
CCAGCAATCATCCCCCTAAGCCCCGCCGCCAAACATCCCCAAGCATACACCTCGTCCTCCAATCCCCTCCCTCTC
CTCATCTGGCACGGCCTAGGCGACACCTTCTCCAGCCCCGGCATCGAAGAAATCGCCTCCCTCGCATCAACCATC
CACCCGGGAACCCTCGTCTACACCATCAGCCTGGGAGGTTCCGACGCCCGAGCCGACCGCTCGGCGACGTTCTTC
GGTAACGTCTCCGCCCAGCTTTCTGACGTCTGCGATGCCATCGCCGCGCATCCCATACTAGCCACCGCCCCGGCC
GTCGACGCCCTCGGTCTGTCGCAAGGGGGCCAGTTCATGCGCGGCTTCGTCGAGCGCTGCAACGTACCGCCCGTT
CGAAGCCTCGTCACGTTCGGAAGCCAGCATAACGGTATTGCGCAGTTTAAGCAGTGTGAGCCGACGGATTGGCTA
TGCGGTGCCGCCATGTTGCTGCTCAAGCATAATACCTGGAGCCATCTCGTTCAGAGCCGTCTCGTGCCCGCCCAG
TACTTCCGCGACCCGGCTGATTACGAGTCCTACCTCGACAACTCCAACTTTCTAGCCGACATCAACAACGAACGT
CCCATCAAGAACGAAACGTACCGCGCCAACCTAGCCCGTCTCGCCAACTTCGTCCTCTACATGTTCGACCACGAC
GAGACCGTCATCCCCAAGGAGACGTCTTGGTTCGCTGAAGTCAACGGCTCCAAGGTGGTGCCCCTGCGCGAGCGT
CGCATCTACACTGAGGATTGGCTGGGTCTGCGCCGTCTGGATGAAAAGGGCGCGCTGCACTTTAGGACCATTCCC
GGCGGCCATATGGATATCCCGCGCCAGTTGCTCAACGATACCATGGCTGAGTTCTTTGGGCCTCTGCGCGAGTCT
ATCTTGTCCGACGAGTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail