Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3056
Gene name
LocationContig_271:1830..5258
Strand+
Gene length (bp)3428
Transcript length (bp)3378
Coding sequence length (bp)3378
Protein length (aa) 1126

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00817 IMS impB/mucB/samB family 1.9E-41 358 514
PF16727 REV1_C DNA repair protein REV1 C-terminal domain 4.7E-24 1034 1123
PF11799 IMS_C impB/mucB/samB family C-terminal domain 6.1E-15 603 720
PF14377 UBM Ubiquitin binding region 2.8E-03 862 888
PF14377 UBM Ubiquitin binding region 1.9E-06 955 986
PF16589 BRCT_2 BRCT domain, a BRCA1 C-terminus domain 5.9E-09 61 147

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94623|REV1_SCHPO DNA repair protein rev1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev1 PE=3 SV=3 284 838 2.0E-106
sp|A3EWL3|REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana GN=REV1 PE=2 SV=1 37 719 2.0E-95
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 241 1089 2.0E-91
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 300 724 4.0E-90
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 300 724 2.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94623|REV1_SCHPO DNA repair protein rev1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev1 PE=3 SV=3 284 838 2.0E-106
sp|A3EWL3|REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana GN=REV1 PE=2 SV=1 37 719 2.0E-95
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 241 1089 2.0E-91
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 300 724 4.0E-90
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 300 724 2.0E-89
sp|Q4KWZ7|REV1_CHICK DNA repair protein REV1 OS=Gallus gallus GN=REV1 PE=2 SV=1 390 894 8.0E-82
sp|P12689|REV1_YEAST DNA repair protein REV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV1 PE=1 SV=2 260 838 1.0E-64
sp|Q9CNG4|DPO4_PASMU DNA polymerase IV OS=Pasteurella multocida (strain Pm70) GN=dinB PE=3 SV=1 353 609 3.0E-37
sp|Q8XZ19|DPO4_RALSO DNA polymerase IV OS=Ralstonia solanacearum (strain GMI1000) GN=dinB PE=3 SV=2 353 637 6.0E-36
sp|B0TZS5|DPO4_FRAP2 DNA polymerase IV OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dinB PE=3 SV=1 353 643 1.0E-35
sp|A7MEN4|DPO4_CROS8 DNA polymerase IV OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dinB PE=3 SV=1 353 641 2.0E-35
sp|Q5PF76|DPO4_SALPA DNA polymerase IV OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dinB PE=3 SV=1 353 637 2.0E-35
sp|B0BPX9|DPO4_ACTPJ DNA polymerase IV OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dinB PE=3 SV=1 352 637 3.0E-35
sp|Q83M86|DPO4_SHIFL DNA polymerase IV OS=Shigella flexneri GN=dinB PE=3 SV=1 353 637 3.0E-35
sp|Q57SU1|DPO4_SALCH DNA polymerase IV OS=Salmonella choleraesuis (strain SC-B67) GN=dinB PE=3 SV=1 353 637 4.0E-35
sp|A1JNY3|DPO4_YERE8 DNA polymerase IV OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dinB PE=3 SV=1 353 637 6.0E-35
sp|Q2A3L2|DPO4_FRATH DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dinB PE=3 SV=1 353 643 8.0E-35
sp|A7NC07|DPO4_FRATF DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=dinB PE=3 SV=1 353 643 8.0E-35
sp|Q12Q05|DPO4_SHEDO DNA polymerase IV OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dinB PE=3 SV=1 353 636 8.0E-35
sp|A7ZHZ2|DPO4_ECO24 DNA polymerase IV OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dinB PE=3 SV=1 353 637 9.0E-35
sp|Q1RFU0|DPO4_ECOUT DNA polymerase IV OS=Escherichia coli (strain UTI89 / UPEC) GN=dinB PE=3 SV=1 353 637 1.0E-34
sp|Q0TL85|DPO4_ECOL5 DNA polymerase IV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=dinB PE=3 SV=1 353 637 1.0E-34
sp|A1A7U2|DPO4_ECOK1 DNA polymerase IV OS=Escherichia coli O1:K1 / APEC GN=dinB PE=3 SV=1 353 637 1.0E-34
sp|A3N148|DPO4_ACTP2 DNA polymerase IV OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dinB PE=3 SV=1 352 637 1.0E-34
sp|Q3Z5A4|DPO4_SHISS DNA polymerase IV OS=Shigella sonnei (strain Ss046) GN=dinB PE=3 SV=1 353 637 1.0E-34
sp|Q47155|DPO4_ECOLI DNA polymerase IV OS=Escherichia coli (strain K12) GN=dinB PE=1 SV=1 353 637 1.0E-34
sp|B1J100|DPO4_ECOLC DNA polymerase IV OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dinB PE=3 SV=1 353 637 1.0E-34
sp|Q65TG8|DPO4_MANSM DNA polymerase IV OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dinB PE=3 SV=1 353 667 1.0E-34
sp|A7ZWJ6|DPO4_ECOHS DNA polymerase IV OS=Escherichia coli O9:H4 (strain HS) GN=dinB PE=3 SV=1 353 637 1.0E-34
sp|Q8X7Q1|DPO4_ECO57 DNA polymerase IV OS=Escherichia coli O157:H7 GN=dinB PE=3 SV=1 353 637 1.0E-34
sp|B2U3S3|DPO4_SHIB3 DNA polymerase IV OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dinB PE=3 SV=1 355 637 2.0E-34
sp|P59477|DPO4_ECOL6 DNA polymerase IV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dinB PE=3 SV=1 353 637 2.0E-34
sp|Q0BM23|DPO4_FRATO DNA polymerase IV OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=dinB PE=3 SV=1 353 643 2.0E-34
sp|P63989|DPO4_SALTY DNA polymerase IV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dinB PE=3 SV=1 353 637 2.0E-34
sp|P63990|DPO4_SALTI DNA polymerase IV OS=Salmonella typhi GN=dinB PE=3 SV=1 353 637 2.0E-34
sp|A9MY13|DPO4_SALPB DNA polymerase IV OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dinB PE=3 SV=1 353 637 2.0E-34
sp|A0Q6K9|DPO4_FRATN DNA polymerase IV OS=Francisella tularensis subsp. novicida (strain U112) GN=dinB PE=3 SV=1 353 643 2.0E-34
sp|Q32J17|DPO4_SHIDS DNA polymerase IV OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dinB PE=3 SV=1 353 637 2.0E-34
sp|B2SH34|DPO4_FRATM DNA polymerase IV OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=dinB PE=3 SV=1 353 643 2.0E-34
sp|Q6MA55|DPO4_PARUW DNA polymerase IV OS=Protochlamydia amoebophila (strain UWE25) GN=dinB PE=3 SV=1 353 638 3.0E-34
sp|Q88NK4|DPO4_PSEPK DNA polymerase IV OS=Pseudomonas putida (strain KT2440) GN=dinB PE=3 SV=1 353 612 3.0E-34
sp|A5VZT3|DPO4_PSEP1 DNA polymerase IV OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dinB PE=3 SV=1 353 612 3.0E-34
sp|Q6FFG4|DPO4_ACIAD DNA polymerase IV OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dinB PE=3 SV=1 353 720 6.0E-34
sp|B0KTK6|DPO4_PSEPG DNA polymerase IV OS=Pseudomonas putida (strain GB-1) GN=dinB PE=3 SV=1 353 612 7.0E-34
sp|A4W6W8|DPO4_ENT38 DNA polymerase IV OS=Enterobacter sp. (strain 638) GN=dinB PE=3 SV=1 353 637 1.0E-33
sp|A9MNS1|DPO4_SALAR DNA polymerase IV OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dinB PE=3 SV=1 353 639 1.0E-33
sp|A0KHD5|DPO4_AERHH DNA polymerase IV OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dinB PE=3 SV=1 353 651 1.0E-33
sp|A8AKQ2|DPO4_CITK8 DNA polymerase IV OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=dinB PE=3 SV=1 353 637 2.0E-33
sp|A4XT24|DPO4_PSEMY DNA polymerase IV OS=Pseudomonas mendocina (strain ymp) GN=dinB PE=3 SV=1 351 637 2.0E-33
sp|Q1I6D5|DPO4_PSEE4 DNA polymerase IV OS=Pseudomonas entomophila (strain L48) GN=dinB PE=3 SV=1 353 612 2.0E-33
sp|Q086K1|DPO4_SHEFN DNA polymerase IV OS=Shewanella frigidimarina (strain NCIMB 400) GN=dinB PE=3 SV=1 353 637 2.0E-33
sp|B1KD33|DPO4_SHEWM DNA polymerase IV OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dinB PE=3 SV=1 353 653 3.0E-33
sp|A3QGY9|DPO4_SHELP DNA polymerase IV OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dinB PE=3 SV=1 355 657 4.0E-33
sp|Q87Y22|DPO4_PSESM DNA polymerase IV OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dinB PE=3 SV=1 352 612 5.0E-33
sp|B8F542|DPO4_HAEPS DNA polymerase IV OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dinB PE=3 SV=1 355 687 5.0E-33
sp|A8FYV3|DPO4_SHESH DNA polymerase IV OS=Shewanella sediminis (strain HAW-EB3) GN=dinB PE=3 SV=1 355 637 7.0E-33
sp|Q6D1H8|DPO4_PECAS DNA polymerase IV OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dinB PE=3 SV=1 353 637 9.0E-33
sp|Q92A40|DPO4_LISIN DNA polymerase IV OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dinB PE=3 SV=1 353 730 1.0E-32
sp|Q9I534|DPO4_PSEAE DNA polymerase IV OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dinB PE=3 SV=1 353 612 1.0E-32
sp|Q02I83|DPO4_PSEAB DNA polymerase IV OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dinB PE=3 SV=1 353 612 1.0E-32
sp|Q4ZWM4|DPO4_PSEU2 DNA polymerase IV OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dinB PE=3 SV=1 352 612 1.0E-32
sp|Q71Y46|DPO4_LISMF DNA polymerase IV OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dinB PE=3 SV=1 353 730 1.0E-32
sp|A0AK80|DPO4_LISW6 DNA polymerase IV OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dinB PE=3 SV=1 353 730 1.0E-32
sp|C1KWR9|DPO4_LISMC DNA polymerase IV OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dinB PE=3 SV=1 353 730 2.0E-32
sp|Q48FB2|DPO4_PSE14 DNA polymerase IV OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dinB PE=3 SV=1 352 612 2.0E-32
sp|A6VA50|DPO4_PSEA7 DNA polymerase IV OS=Pseudomonas aeruginosa (strain PA7) GN=dinB PE=3 SV=1 353 612 2.0E-32
sp|Q3BP42|DPO4_XANC5 DNA polymerase IV OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dinB PE=3 SV=1 353 609 3.0E-32
sp|Q8PGJ4|DPO4_XANAC DNA polymerase IV OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dinB PE=3 SV=1 353 609 4.0E-32
sp|A8GAC8|DPO4_SERP5 DNA polymerase IV OS=Serratia proteamaculans (strain 568) GN=dinB PE=3 SV=1 353 637 5.0E-32
sp|A9L0T3|DPO4_SHEB9 DNA polymerase IV OS=Shewanella baltica (strain OS195) GN=dinB PE=3 SV=1 353 637 7.0E-32
sp|B8DBV7|DPO4_LISMH DNA polymerase IV OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dinB PE=3 SV=1 353 730 9.0E-32
sp|Q8PCW8|DPO4_XANCP DNA polymerase IV OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dinB PE=3 SV=1 353 609 1.0E-31
sp|Q4UQI2|DPO4_XANC8 DNA polymerase IV OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dinB PE=3 SV=1 353 609 1.0E-31
sp|P58963|DPO4_ESCFE DNA polymerase IV (Fragment) OS=Escherichia fergusonii GN=dinB PE=3 SV=1 363 637 1.0E-31
sp|Q64X95|DPO4_BACFR DNA polymerase IV OS=Bacteroides fragilis (strain YCH46) GN=dinB PE=3 SV=1 353 651 1.0E-31
sp|A3D147|DPO4_SHEB5 DNA polymerase IV OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dinB PE=3 SV=1 353 637 1.0E-31
sp|A6WRW5|DPO4_SHEB8 DNA polymerase IV OS=Shewanella baltica (strain OS185) GN=dinB PE=3 SV=1 353 637 2.0E-31
sp|A0KTR5|DPO4_SHESA DNA polymerase IV OS=Shewanella sp. (strain ANA-3) GN=dinB PE=3 SV=1 353 653 2.0E-31
sp|Q5ZY20|DPO4_LEGPH DNA polymerase IV OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dinB PE=3 SV=1 353 612 2.0E-31
sp|A1KUQ3|DPO4_NEIMF DNA polymerase IV OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dinB PE=3 SV=1 353 651 2.0E-31
sp|A3CSG3|DPO4_METMJ DNA polymerase IV OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=dbh PE=3 SV=1 353 654 3.0E-31
sp|Q8Y5T0|DPO4_LISMO DNA polymerase IV OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dinB PE=3 SV=1 353 730 3.0E-31
sp|Q87MB4|DPO4_VIBPA DNA polymerase IV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dinB PE=3 SV=1 353 637 3.0E-31
sp|Q5X7J1|DPO4_LEGPA DNA polymerase IV OS=Legionella pneumophila (strain Paris) GN=dinB PE=3 SV=1 353 612 3.0E-31
sp|Q8PT42|DPO42_METMA DNA polymerase IV 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dbh2 PE=3 SV=1 346 718 4.0E-31
sp|B8FBE8|DPO4_DESAA DNA polymerase IV OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dinB PE=3 SV=1 355 651 4.0E-31
sp|Q5WYY8|DPO4_LEGPL DNA polymerase IV OS=Legionella pneumophila (strain Lens) GN=dinB PE=3 SV=1 353 612 4.0E-31
sp|A5IH02|DPO4_LEGPC DNA polymerase IV OS=Legionella pneumophila (strain Corby) GN=dinB PE=3 SV=1 353 612 5.0E-31
sp|Q3KH18|DPO4_PSEPF DNA polymerase IV OS=Pseudomonas fluorescens (strain Pf0-1) GN=dinB PE=3 SV=1 352 614 5.0E-31
sp|Q0HLP0|DPO4_SHESM DNA polymerase IV OS=Shewanella sp. (strain MR-4) GN=dinB PE=3 SV=1 353 653 7.0E-31
sp|Q0HY21|DPO4_SHESR DNA polymerase IV OS=Shewanella sp. (strain MR-7) GN=dinB PE=3 SV=1 353 653 9.0E-31
sp|Q2P7M9|DPO4_XANOM DNA polymerase IV OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dinB PE=3 SV=1 353 609 1.0E-30
sp|Q9JYS8|DPO4_NEIMB DNA polymerase IV OS=Neisseria meningitidis serogroup B (strain MC58) GN=dinB PE=3 SV=1 353 651 1.0E-30
sp|A1RMZ5|DPO4_SHESW DNA polymerase IV OS=Shewanella sp. (strain W3-18-1) GN=dinB PE=3 SV=1 353 637 2.0E-30
sp|Q8EHU9|DPO4_SHEON DNA polymerase IV OS=Shewanella oneidensis (strain MR-1) GN=dinB PE=3 SV=1 353 637 3.0E-30
sp|B0TQD1|DPO4_SHEHH DNA polymerase IV OS=Shewanella halifaxensis (strain HAW-EB4) GN=dinB PE=3 SV=1 355 653 3.0E-30
sp|Q5F8N2|DPO4_NEIG1 DNA polymerase IV OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dinB PE=3 SV=1 353 651 4.0E-30
sp|Q9JRG1|DPO4_NEIMA DNA polymerase IV OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dinB PE=3 SV=1 353 651 4.0E-30
sp|B9DMT3|DPO4_STACT DNA polymerase IV OS=Staphylococcus carnosus (strain TM300) GN=dinB PE=3 SV=1 350 651 5.0E-30
sp|Q7N7B6|DPO4_PHOLL DNA polymerase IV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dinB PE=3 SV=1 353 637 9.0E-30
sp|Q4L7K8|DPO4_STAHJ DNA polymerase IV OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dinB PE=3 SV=1 350 651 9.0E-30
sp|A1WY69|DPO4_HALHL DNA polymerase IV OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dinB PE=3 SV=1 353 651 1.0E-29
sp|Q2YU32|DPO4_STAAB DNA polymerase IV OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dinB PE=3 SV=1 351 651 1.0E-29
sp|B4SIF5|DPO4_STRM5 DNA polymerase IV OS=Stenotrophomonas maltophilia (strain R551-3) GN=dinB PE=3 SV=1 353 609 2.0E-29
sp|Q88V07|DPO4_LACPL DNA polymerase IV OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dinB PE=3 SV=2 353 724 2.0E-29
sp|P58964|DPO4_STAAW DNA polymerase IV OS=Staphylococcus aureus (strain MW2) GN=dinB PE=3 SV=1 351 651 2.0E-29
sp|Q6G838|DPO4_STAAS DNA polymerase IV OS=Staphylococcus aureus (strain MSSA476) GN=dinB PE=3 SV=1 351 651 2.0E-29
sp|A6QIC3|DPO4_STAAE DNA polymerase IV OS=Staphylococcus aureus (strain Newman) GN=dinB PE=3 SV=1 351 651 2.0E-29
sp|Q5HEM7|DPO4_STAAC DNA polymerase IV OS=Staphylococcus aureus (strain COL) GN=dinB PE=3 SV=1 351 651 2.0E-29
sp|Q8F8Q2|DPO4_LEPIN DNA polymerase IV OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dinB PE=3 SV=2 351 651 3.0E-29
sp|P9WNT1|DPO42_MYCTU DNA polymerase IV 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dinB2 PE=3 SV=1 348 651 3.0E-29
sp|P9WNT0|DPO42_MYCTO DNA polymerase IV 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dinB2 PE=3 SV=1 348 651 3.0E-29
sp|P63988|DPO42_MYCBO DNA polymerase IV 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dinB2 PE=3 SV=1 348 651 3.0E-29
sp|A4TPK8|DPO4_YERPP DNA polymerase IV OS=Yersinia pestis (strain Pestoides F) GN=dinB PE=3 SV=1 353 609 3.0E-29
sp|Q1CLD4|DPO4_YERPN DNA polymerase IV OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dinB PE=3 SV=1 353 609 3.0E-29
sp|Q8ZBZ9|DPO4_YERPE DNA polymerase IV OS=Yersinia pestis GN=dinB PE=3 SV=1 353 609 3.0E-29
sp|Q1C4D9|DPO4_YERPA DNA polymerase IV OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dinB PE=3 SV=1 353 609 3.0E-29
sp|Q72MY7|DPO4_LEPIC DNA polymerase IV OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dinB PE=3 SV=2 351 651 4.0E-29
sp|B2FLR2|DPO4_STRMK DNA polymerase IV OS=Stenotrophomonas maltophilia (strain K279a) GN=dinB PE=3 SV=1 353 656 4.0E-29
sp|Q9AK82|DPO4_STRCO DNA polymerase IV OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dinB PE=3 SV=2 354 718 4.0E-29
sp|Q66DZ7|DPO4_YERPS DNA polymerase IV OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dinB PE=3 SV=1 353 609 4.0E-29
sp|A7FLI9|DPO4_YERP3 DNA polymerase IV OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dinB PE=3 SV=1 353 609 4.0E-29
sp|A5IU61|DPO4_STAA9 DNA polymerase IV OS=Staphylococcus aureus (strain JH9) GN=dinB PE=3 SV=1 351 651 4.0E-29
sp|A6U2Z9|DPO4_STAA2 DNA polymerase IV OS=Staphylococcus aureus (strain JH1) GN=dinB PE=3 SV=1 351 651 4.0E-29
sp|P63992|DPO4_STAAN DNA polymerase IV OS=Staphylococcus aureus (strain N315) GN=dinB PE=3 SV=1 351 651 5.0E-29
sp|P63991|DPO4_STAAM DNA polymerase IV OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dinB PE=3 SV=1 351 651 5.0E-29
sp|A7X420|DPO4_STAA1 DNA polymerase IV OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dinB PE=3 SV=1 351 651 5.0E-29
sp|Q6GFG2|DPO4_STAAR DNA polymerase IV OS=Staphylococcus aureus (strain MRSA252) GN=dinB PE=3 SV=1 351 651 5.0E-29
sp|P58965|DPO4_CALS4 DNA polymerase IV OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dinB PE=3 SV=1 352 724 5.0E-29
sp|A1S8M3|DPO4_SHEAM DNA polymerase IV OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dinB PE=3 SV=1 353 637 9.0E-29
sp|A1U339|DPO4_MARHV DNA polymerase IV OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dinB PE=3 SV=1 352 646 1.0E-28
sp|Q7MID6|DPO4_VIBVY DNA polymerase IV OS=Vibrio vulnificus (strain YJ016) GN=dinB PE=3 SV=2 349 668 1.0E-28
sp|Q8DBI7|DPO4_VIBVU DNA polymerase IV OS=Vibrio vulnificus (strain CMCP6) GN=dinB PE=3 SV=2 349 668 1.0E-28
sp|A8H771|DPO4_SHEPA DNA polymerase IV OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dinB PE=3 SV=1 355 653 2.0E-28
sp|Q3ABL2|DPO4_CARHZ DNA polymerase IV OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dinB PE=3 SV=1 351 611 3.0E-28
sp|A4VZ21|DPO4_STRS2 DNA polymerase IV OS=Streptococcus suis (strain 98HAH33) GN=dinB PE=3 SV=1 353 719 3.0E-28
sp|Q02WA3|DPO4_LACLS DNA polymerase IV OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dinB PE=3 SV=1 353 651 3.0E-28
sp|Q6AL48|DPO4_DESPS DNA polymerase IV OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=dinB PE=3 SV=1 353 651 4.0E-28
sp|B1YK83|DPO4_EXIS2 DNA polymerase IV OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dinB PE=3 SV=1 353 719 4.0E-28
sp|A2RNH9|DPO4_LACLM DNA polymerase IV OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dinB PE=3 SV=1 353 651 5.0E-28
sp|Q9A5I1|DPO4_CAUCR DNA polymerase IV OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dinB PE=3 SV=2 355 651 6.0E-28
sp|Q49YT9|DPO4_STAS1 DNA polymerase IV OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dinB PE=3 SV=1 351 651 8.0E-28
sp|Q8PYH6|DPO41_METMA DNA polymerase IV 1 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dbh1 PE=3 SV=1 352 666 9.0E-28
sp|Q8UJK7|DPO42_AGRFC DNA polymerase IV 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dinB2 PE=3 SV=2 353 651 1.0E-27
sp|A8AUV7|DPO4_STRGC DNA polymerase IV OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dinB PE=3 SV=1 353 719 2.0E-27
sp|Q73P36|DPO4_TREDE DNA polymerase IV OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dinB PE=3 SV=1 353 651 2.0E-27
sp|Q974T8|DPO4_SULTO DNA polymerase IV OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=dbh PE=3 SV=2 355 578 2.0E-27
sp|Q5LYC2|DPO4_STRT1 DNA polymerase IV OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dinB PE=3 SV=1 353 719 4.0E-27
sp|B2UKN1|DPO4_AKKM8 DNA polymerase IV OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=dinB PE=3 SV=1 352 651 7.0E-27
sp|Q5XA48|DPO4_STRP6 DNA polymerase IV OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dinB PE=3 SV=1 353 719 8.0E-27
sp|Q99Y66|DPO4_STRP1 DNA polymerase IV OS=Streptococcus pyogenes serotype M1 GN=dinB PE=3 SV=2 353 719 9.0E-27
sp|Q1JF59|DPO4_STRPD DNA polymerase IV OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dinB PE=3 SV=1 353 719 1.0E-26
sp|Q487H6|DPO4_COLP3 DNA polymerase IV OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dinB PE=3 SV=1 350 637 1.0E-26
sp|A5F5Y1|DPO4_VIBC3 DNA polymerase IV OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dinB PE=3 SV=1 353 637 1.0E-26
sp|Q48RJ4|DPO4_STRPM DNA polymerase IV OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dinB PE=3 SV=1 353 719 1.0E-26
sp|A9A3A9|DPO4_NITMS DNA polymerase IV OS=Nitrosopumilus maritimus (strain SCM1) GN=dbh PE=3 SV=1 351 602 1.0E-26
sp|Q8REB0|DPO4_FUSNN DNA polymerase IV OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=dinB PE=3 SV=1 353 713 1.0E-26
sp|Q8TIW3|DPO4_METAC DNA polymerase IV OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dbh PE=3 SV=1 352 600 1.0E-26
sp|C3LQ59|DPO4_VIBCM DNA polymerase IV OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dinB PE=3 SV=1 353 637 1.0E-26
sp|Q9KPS5|DPO4_VIBCH DNA polymerase IV OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dinB PE=3 SV=1 353 637 1.0E-26
sp|A6W1V6|DPO4_MARMS DNA polymerase IV OS=Marinomonas sp. (strain MWYL1) GN=dinB PE=3 SV=1 351 637 2.0E-26
sp|Q15YP8|DPO4_PSEA6 DNA polymerase IV OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dinB PE=3 SV=1 353 637 2.0E-26
sp|Q8NZI1|DPO4_STRP8 DNA polymerase IV OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dinB PE=3 SV=1 353 719 3.0E-26
sp|A2RCQ1|DPO4_STRPG DNA polymerase IV OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dinB PE=3 SV=1 353 719 3.0E-26
sp|Q18A91|DPO4_PEPD6 DNA polymerase IV OS=Peptoclostridium difficile (strain 630) GN=dinB PE=3 SV=1 353 722 4.0E-26
sp|Q1J509|DPO4_STRPF DNA polymerase IV OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dinB PE=3 SV=1 353 719 5.0E-26
sp|Q1JK63|DPO4_STRPC DNA polymerase IV OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dinB PE=3 SV=1 353 719 6.0E-26
sp|Q1JA16|DPO4_STRPB DNA polymerase IV OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=dinB PE=3 SV=1 353 719 6.0E-26
sp|A3CKU4|DPO4_STRSV DNA polymerase IV OS=Streptococcus sanguinis (strain SK36) GN=dinB PE=3 SV=1 353 719 1.0E-25
sp|A5N2U5|DPO4_CLOK5 DNA polymerase IV OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dinB PE=3 SV=1 353 597 1.0E-25
sp|Q8DXW9|DPO4_STRA5 DNA polymerase IV OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dinB PE=3 SV=1 353 719 1.0E-25
sp|Q8E3I8|DPO4_STRA3 DNA polymerase IV OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dinB PE=3 SV=1 353 719 1.0E-25
sp|Q3JZG9|DPO4_STRA1 DNA polymerase IV OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dinB PE=3 SV=1 353 719 1.0E-25
sp|Q5M2Y5|DPO4_STRT2 DNA polymerase IV OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dinB PE=3 SV=1 353 719 1.0E-25
sp|Q92XH8|DPO42_RHIME DNA polymerase IV 2 OS=Rhizobium meliloti (strain 1021) GN=dinB2 PE=3 SV=2 353 651 2.0E-25
sp|Q3ZWB2|DPO4_DEHMC DNA polymerase IV OS=Dehalococcoides mccartyi (strain CBDB1) GN=dinB PE=3 SV=1 353 668 2.0E-25
sp|Q8DVR7|DPO4_STRMU DNA polymerase IV OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dinB PE=3 SV=1 353 719 2.0E-25
sp|Q0A4X2|DPO4_ALKEH DNA polymerase IV OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dinB PE=3 SV=1 353 651 3.0E-25
sp|Q8CNP3|DPO4_STAES DNA polymerase IV OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dinB PE=3 SV=1 351 651 4.0E-25
sp|Q03J54|DPO4_STRTD DNA polymerase IV OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dinB PE=3 SV=1 353 719 4.0E-25
sp|O94623|REV1_SCHPO DNA repair protein rev1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev1 PE=3 SV=3 21 164 5.0E-25
sp|Q5FSM8|DPO4_GLUOX DNA polymerase IV OS=Gluconobacter oxydans (strain 621H) GN=dinB PE=3 SV=1 351 651 5.0E-25
sp|P12689|REV1_YEAST DNA repair protein REV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV1 PE=1 SV=2 56 167 9.0E-25
sp|Q5HN39|DPO4_STAEQ DNA polymerase IV OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dinB PE=3 SV=1 351 651 1.0E-24
sp|Q9CE21|DPO4_LACLA DNA polymerase IV OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dinB PE=3 SV=1 353 651 1.0E-24
sp|Q8UFV3|DPO41_AGRFC DNA polymerase IV 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dinB1 PE=3 SV=2 355 651 1.0E-24
sp|Q6NGD8|DPO4_CORDI DNA polymerase IV OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=dinB PE=3 SV=1 352 729 1.0E-24
sp|Q8EQ56|DPO4_OCEIH DNA polymerase IV OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dinB PE=3 SV=1 350 651 2.0E-24
sp|Q0SSQ2|DPO4_CLOPS DNA polymerase IV OS=Clostridium perfringens (strain SM101 / Type A) GN=dinB PE=3 SV=1 351 651 2.0E-24
sp|Q98JM5|DPO42_RHILO DNA polymerase IV 2 OS=Rhizobium loti (strain MAFF303099) GN=dinB2 PE=3 SV=1 354 651 2.0E-24
sp|A5FSS1|DPO4_DEHMB DNA polymerase IV OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dinB PE=3 SV=1 353 612 2.0E-24
sp|Q3II35|DPO4_PSEHT DNA polymerase IV OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dinB PE=3 SV=1 355 645 3.0E-24
sp|Q7USY7|DPO4_RHOBA DNA polymerase IV OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dinB PE=3 SV=1 354 597 4.0E-24
sp|P0DA79|DPO4_STRPQ DNA polymerase IV OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dinB PE=3 SV=1 353 719 5.0E-24
sp|P0DA78|DPO4_STRP3 DNA polymerase IV OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dinB PE=3 SV=1 353 719 5.0E-24
sp|Q8XK37|DPO4_CLOPE DNA polymerase IV OS=Clostridium perfringens (strain 13 / Type A) GN=dinB PE=3 SV=1 351 651 5.0E-24
sp|Q818U9|DPO4_BACCR DNA polymerase IV OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dinB PE=3 SV=1 353 637 8.0E-24
sp|Q0TQ38|DPO4_CLOP1 DNA polymerase IV OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=dinB PE=3 SV=1 351 651 9.0E-24
sp|P96022|DPO4_SULSF DNA polymerase IV OS=Sulfolobus solfataricus GN=dbh PE=1 SV=1 355 578 9.0E-24
sp|Q4JB80|DPO4_SULAC DNA polymerase IV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=dbh PE=1 SV=1 355 578 9.0E-24
sp|Q9UNA4|POLI_HUMAN DNA polymerase iota OS=Homo sapiens GN=POLI PE=1 SV=3 335 702 1.0E-23
sp|Q98NW7|DPO43_RHILO DNA polymerase IV 3 OS=Rhizobium loti (strain MAFF303099) GN=dinB3 PE=3 SV=1 353 651 1.0E-23
sp|A7Z6F3|DPO4_BACMF DNA polymerase IV OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dinB PE=3 SV=1 349 598 1.0E-23
sp|Q9PQ53|DPO4_UREPA DNA polymerase IV OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=dinB PE=3 SV=2 349 607 2.0E-23
sp|B1AJ79|DPO4_UREP2 DNA polymerase IV OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=dinB PE=3 SV=1 349 607 2.0E-23
sp|A8MGJ5|DPO4_ALKOO DNA polymerase IV OS=Alkaliphilus oremlandii (strain OhILAs) GN=dinB PE=3 SV=1 354 650 2.0E-23
sp|Q3ZAI3|DPO4_DEHM1 DNA polymerase IV OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dinB PE=3 SV=1 353 612 1.0E-22
sp|Q97SC7|DPO4_STRPN DNA polymerase IV OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dinB PE=3 SV=2 353 651 3.0E-22
sp|Q8DQZ7|DPO4_STRR6 DNA polymerase IV OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dinB PE=3 SV=2 353 651 4.0E-22
sp|Q04M21|DPO4_STRP2 DNA polymerase IV OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dinB PE=3 SV=1 353 651 4.0E-22
sp|B5ZBT4|DPO4_UREU1 DNA polymerase IV OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=dinB PE=3 SV=1 349 657 6.0E-22
sp|Q9Y253|POLH_HUMAN DNA polymerase eta OS=Homo sapiens GN=POLH PE=1 SV=1 349 640 8.0E-22
sp|Q6A763|DPO4_PROAC DNA polymerase IV OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dinB PE=3 SV=1 355 718 9.0E-22
sp|A4QFK8|DPO4_CORGB DNA polymerase IV OS=Corynebacterium glutamicum (strain R) GN=dinB PE=3 SV=1 352 736 1.0E-21
sp|P54545|DPO41_BACSU DNA polymerase IV 1 OS=Bacillus subtilis (strain 168) GN=dinB1 PE=3 SV=2 350 704 1.0E-21
sp|Q6R3M4|POLI_MOUSE DNA polymerase iota OS=Mus musculus GN=Poli PE=1 SV=1 353 657 1.0E-21
sp|Q8YC76|DPO4_BRUME DNA polymerase IV OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dinB PE=3 SV=1 352 651 1.0E-21
sp|Q81M86|DPO4_BACAN DNA polymerase IV OS=Bacillus anthracis GN=dinB PE=3 SV=1 353 637 2.0E-21
sp|Q8NNP4|DPO4_CORGL DNA polymerase IV OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=dinB PE=3 SV=1 352 736 2.0E-21
sp|O74944|POLK_SCHPO DNA polymerase kappa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug40 PE=1 SV=3 329 718 2.0E-21
sp|Q97W02|DPO4_SULSO DNA polymerase IV OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=dbh PE=1 SV=1 355 590 2.0E-21
sp|Q9JJN0|POLH_MOUSE DNA polymerase eta OS=Mus musculus GN=Polh PE=1 SV=1 350 612 2.0E-21
sp|Q8FW50|DPO4_BRUSU DNA polymerase IV OS=Brucella suis biovar 1 (strain 1330) GN=dinB PE=3 SV=1 352 651 3.0E-21
sp|P9WNT3|DPO41_MYCTU DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dinB1 PE=1 SV=1 351 651 4.0E-21
sp|P9WNT2|DPO41_MYCTO DNA polymerase IV 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dinB1 PE=3 SV=1 351 651 4.0E-21
sp|P63986|DPO41_MYCBO DNA polymerase IV 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dinB1 PE=3 SV=1 351 651 4.0E-21
sp|Q635E0|DPO4_BACCZ DNA polymerase IV OS=Bacillus cereus (strain ZK / E33L) GN=dinB PE=3 SV=1 353 637 5.0E-21
sp|A4YEC1|DPO4_METS5 DNA polymerase IV OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=dbh PE=3 SV=1 355 583 8.0E-21
sp|Q98LV1|DPO41_RHILO DNA polymerase IV 1 OS=Rhizobium loti (strain MAFF303099) GN=dinB1 PE=3 SV=1 345 651 9.0E-21
sp|A3DH61|DPO4_CLOTH DNA polymerase IV OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dinB PE=3 SV=1 352 718 1.0E-20
sp|Q67QM6|DPO4_SYMTH DNA polymerase IV OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dinB PE=3 SV=1 355 718 2.0E-20
sp|Q6KZW2|DPO4_PICTO DNA polymerase IV OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dbh PE=3 SV=1 355 578 3.0E-20
sp|Q92QM8|DPO41_RHIME DNA polymerase IV 1 OS=Rhizobium meliloti (strain 1021) GN=dinB1 PE=3 SV=1 352 651 1.0E-19
sp|Q9HQT4|DPO4_HALSA DNA polymerase IV OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=dbh PE=3 SV=2 348 612 3.0E-19
sp|B0R4P0|DPO4_HALS3 DNA polymerase IV OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=dbh PE=3 SV=1 348 612 3.0E-19
sp|P34409|POLK_CAEEL DNA polymerase kappa OS=Caenorhabditis elegans GN=polk-1 PE=3 SV=3 352 651 1.0E-18
sp|Q9K9A8|DPO42_BACHD DNA polymerase IV 2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dinB2 PE=3 SV=1 353 659 8.0E-18
sp|Q49426|Y360_MYCGE Uncharacterized protein MG360 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG360 PE=3 SV=1 355 546 7.0E-17
sp|Q8H2D5|POLH_ARATH DNA polymerase eta OS=Arabidopsis thaliana GN=POLH PE=1 SV=1 345 647 1.0E-16
sp|Q9KCU7|DPO41_BACHD DNA polymerase IV 1 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dinB1 PE=3 SV=1 350 546 5.0E-16
sp|B1ZN03|DPO4_OPITP DNA polymerase IV OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dinB PE=3 SV=1 355 651 6.0E-16
sp|Q97MB3|DPO4_CLOAB DNA polymerase IV OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dinB PE=3 SV=1 353 637 1.0E-15
sp|A5D243|DPO4_PELTS DNA polymerase IV OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=dinB PE=3 SV=1 353 651 9.0E-15
sp|Q2RJ46|DPO4_MOOTA DNA polymerase IV OS=Moorella thermoacetica (strain ATCC 39073) GN=dinB PE=3 SV=1 355 637 4.0E-14
sp|Q5R4N7|REV1_PONAB DNA repair protein REV1 OS=Pongo abelii GN=REV1 PE=2 SV=1 13 148 7.0E-14
sp|Q9UBZ9|REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 13 148 7.0E-14
sp|Q9QUG2|POLK_MOUSE DNA polymerase kappa OS=Mus musculus GN=Polk PE=1 SV=1 355 466 7.0E-14
sp|Q920Q2|REV1_MOUSE DNA repair protein REV1 OS=Mus musculus GN=Rev1 PE=1 SV=1 13 148 1.0E-13
sp|Q9UBT6|POLK_HUMAN DNA polymerase kappa OS=Homo sapiens GN=POLK PE=1 SV=1 316 466 6.0E-13
sp|Q4KWZ7|REV1_CHICK DNA repair protein REV1 OS=Gallus gallus GN=REV1 PE=2 SV=1 29 148 1.0E-11
sp|P75241|Y537_MYCPN Uncharacterized protein MG360 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_537 PE=3 SV=1 372 546 1.0E-11
sp|P54560|DPO42_BACSU DNA polymerase IV 2 OS=Bacillus subtilis (strain 168) GN=dinB2 PE=3 SV=1 351 597 3.0E-09
sp|Q4KWZ7|REV1_CHICK DNA repair protein REV1 OS=Gallus gallus GN=REV1 PE=2 SV=1 266 389 9.0E-09
sp|Q9QUG2|POLK_MOUSE DNA polymerase kappa OS=Mus musculus GN=Polk PE=1 SV=1 481 651 3.0E-07
sp|Q9UBT6|POLK_HUMAN DNA polymerase kappa OS=Homo sapiens GN=POLK PE=1 SV=1 481 651 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003684 damaged DNA binding Yes
GO:0006281 DNA repair Yes
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0006259 DNA metabolic process No
GO:0050896 response to stimulus No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0033554 cellular response to stress No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006950 response to stress No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1333
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|218
Ophiocordyceps australis map64 (Brazil) OphauB2|509
Ophiocordyceps camponoti-floridani Ophcf2|07268
Ophiocordyceps camponoti-rufipedis Ophun1|3056 (this protein)
Ophiocordyceps kimflemingae Ophio5|1893
Ophiocordyceps subramaniannii Hirsu2|10701

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3056
MGSVLEKNSSSVRKRIEKHSFEDEDGEEYEASKFHGFGDYFRRKKIKLQNLDAETRAASEKPQIFKGIVAHITGY
TQPPLHILHREIVQHGGCFLQYLDSKTMATHIIASALPPKKTVDFSRYRIVKPTWIVDSVKAGKLLPWSDYRLAD
EGPRQRVLKLDGDKTISQKSPQARRGYREQTDNSFYTSQMKATAATLPSQGLSQVAEQLLTPGTIQSTSRPLERH
KIYGTNNRIDGSPTASKRSASSPSDISKPPPSAQTRSPPLPSDTSAPTADTTPTKAMTSEEHNSWLLSDPRLRKS
STANPDFLKQFYSESRLHHLSTWKANLKSTMQRLAAERGLNQGKSRRPSGERRCILHVDFDSFFCAVSLKRHPEL
VDKPTVVAHSPGPGSEIASCNYPARKFGVKNGMWMRRAMELCPDLKVLPYDFPAYEQASRLFYEAILAIGGVVQS
VSVDEALIDVTSVVSEAGADKDTVMREQQKADELATWLRQQIKTKTGCHVSVGIGGNILQAKVALRKAKPAGQFH
LKPEDVLGIIGELRVEELPGVSYSIGGKLEELGVRLVKNIREVSKDRLASALGPKTGEKLADYARGIDRTEVGEQ
PPRKSVSAEVNWGIRFISQQEAEEFVYNLCKELEKRLVSEQVKGKHLTMKIMRRCLDAPLDPTKHLGHGKCDSFN
KSATFGVATHNYDVIGKEAVSILRSFKFSPGDLRGLGVQMTKLEPIKIQARAPEGSQRTLTFGAFAGPGSAKKAS
RPEQIDDVESPTKPRVPGNRDIEKDPIAEDPVTPRKQHFHPAMALSRAAQDDAKATTPLNVSGTQFLIPSNPDPA
VIAELPYDIRSRLMSQRARSSPSRPVPRTESPVAAEVLPSQVDAQVFNALPDDMKAEVLATYGRKPAQPLRKQSP
RKDADSLSRRLTLPTPRRGGGRGIMGKAQRQRDSRAGVLQTTFKAIKRDDTPTEDEVEELDAEFLAELPEDVRQE
VMADHRRRRMARRSGLEAAVQRQRVTDGDGSLPGGQRRIHFPVPRPKIAFSGGVTSTPEIKTMLDGWHDETRDQG
PHGDDVEVLERYLAQVVLEEGDLHKAVMLVKWLDVLVEQDGGGAAGCAAWREVMCRVKGAVQQAVEQKGLAPLSL
*
Coding >Ophun1|3056
ATGGGCAGTGTTTTGGAGAAAAACTCATCGTCAGTGAGGAAGCGGATCGAGAAGCACTCGTTCGAAGACGAAGAT
GGCGAAGAGTACGAGGCCAGCAAGTTCCACGGCTTCGGCGACTACTTCCGGCGCAAAAAGATCAAGCTGCAGAAT
CTGGACGCCGAGACTCGGGCGGCGTCTGAGAAGCCCCAGATCTTCAAAGGCATTGTTGCTCATATTACAGGCTAC
ACGCAGCCCCCTCTTCACATACTCCATCGCGAGATTGTCCAGCATGGCGGGTGCTTCCTCCAATATCTCGACTCC
AAAACCATGGCGACGCACATCATTGCCTCGGCGTTGCCTCCCAAGAAGACTGTTGACTTTAGCCGCTACAGGATT
GTGAAGCCGACGTGGATCGTTGACTCGGTGAAAGCTGGGAAACTGCTCCCGTGGTCCGACTACCGCCTTGCAGAC
GAGGGCCCGCGGCAAAGGGTCTTGAAGCTGGACGGTGACAAGACTATCTCGCAGAAAAGCCCGCAGGCCAGACGG
GGCTACAGAGAGCAGACGGACAATAGCTTCTATACGAGCCAGATGAAAGCAACGGCAGCAACTCTGCCGAGTCAG
GGCCTGAGCCAAGTGGCGGAACAGCTGCTGACACCTGGCACCATCCAGTCAACGAGCCGGCCACTCGAACGGCAC
AAGATATATGGTACGAACAACAGGATTGATGGGTCCCCAACCGCCTCAAAACGCTCAGCCTCTAGTCCTTCCGAC
ATCTCGAAGCCTCCGCCGTCGGCTCAAACCCGGTCTCCCCCGTTGCCGTCCGATACATCGGCACCGACGGCTGAT
ACGACACCTACAAAGGCTATGACATCAGAGGAACACAACTCTTGGCTGCTCTCGGATCCACGGCTGCGCAAGTCG
TCGACGGCAAACCCCGACTTCCTCAAGCAATTCTACTCTGAGAGCAGGCTGCATCACCTCTCCACGTGGAAAGCC
AACCTCAAGTCGACGATGCAGCGACTGGCGGCGGAGAGAGGTCTCAACCAGGGCAAATCTAGACGACCTTCAGGA
GAAAGGAGATGTATTCTGCACGTCGACTTTGACAGCTTCTTCTGCGCTGTATCCCTCAAGAGACACCCAGAGCTC
GTCGACAAACCGACAGTCGTGGCTCACAGTCCAGGCCCAGGCTCCGAGATTGCAAGCTGCAACTATCCCGCTCGA
AAGTTTGGCGTCAAGAATGGCATGTGGATGAGGCGTGCCATGGAGCTGTGCCCCGATCTCAAGGTCTTGCCCTAC
GACTTTCCCGCTTACGAACAAGCCAGCCGACTATTCTACGAAGCCATCTTGGCCATCGGCGGCGTTGTTCAAAGT
GTAAGCGTGGATGAGGCCTTGATTGATGTGACTTCGGTCGTCTCGGAGGCCGGTGCCGATAAAGACACCGTCATG
AGAGAGCAACAAAAGGCCGACGAGCTGGCAACTTGGTTGAGACAACAGATCAAGACCAAGACAGGCTGCCACGTT
TCTGTCGGCATAGGCGGTAACATCCTGCAAGCCAAGGTTGCGTTGAGGAAAGCAAAGCCGGCAGGCCAATTTCAC
CTCAAGCCCGAGGATGTACTCGGAATCATCGGGGAGCTGAGAGTCGAGGAACTGCCAGGCGTCTCCTACAGCATC
GGCGGGAAGCTGGAGGAGCTGGGCGTCAGGCTCGTCAAGAACATACGGGAAGTGTCCAAAGACAGGCTGGCATCG
GCTCTGGGGCCCAAGACCGGGGAGAAGCTGGCCGACTACGCGCGAGGCATCGACCGGACAGAAGTCGGAGAGCAG
CCGCCTCGAAAGTCGGTGTCGGCAGAGGTCAACTGGGGCATCCGCTTCATCAGCCAGCAGGAAGCTGAGGAGTTT
GTGTACAACCTGTGCAAGGAGCTGGAAAAGCGACTGGTGAGCGAGCAGGTCAAGGGGAAACATCTCACCATGAAG
ATTATGAGGAGGTGTCTTGATGCTCCGCTGGATCCTACAAAGCATCTGGGCCACGGGAAATGCGACAGCTTCAAC
AAGAGCGCAACATTTGGCGTTGCCACGCACAATTACGACGTCATCGGCAAGGAGGCCGTCTCGATATTGCGGTCT
TTCAAGTTCAGCCCCGGTGACCTGAGAGGCCTCGGGGTCCAGATGACGAAGCTCGAACCGATCAAGATACAGGCG
AGAGCACCGGAAGGCAGTCAGCGGACCTTGACCTTTGGTGCCTTTGCAGGACCAGGCTCGGCGAAGAAGGCATCT
CGGCCGGAGCAGATTGACGATGTCGAAAGCCCAACGAAGCCGAGAGTCCCCGGAAACCGTGATATTGAAAAGGAC
CCCATCGCCGAGGATCCCGTGACGCCTCGAAAGCAGCATTTCCACCCGGCCATGGCTCTCTCGAGGGCGGCGCAG
GATGACGCAAAGGCAACGACTCCGTTGAACGTGTCGGGCACGCAGTTTCTCATCCCCAGCAATCCGGATCCCGCC
GTCATTGCGGAGCTGCCGTACGATATCCGGAGCAGGTTGATGAGCCAGCGAGCCAGATCCAGTCCGTCTCGCCCG
GTTCCTCGAACCGAAAGTCCCGTGGCCGCTGAAGTGCTTCCGTCTCAGGTCGATGCCCAAGTTTTCAACGCGCTG
CCGGATGATATGAAGGCTGAGGTGCTGGCCACTTACGGTCGTAAGCCAGCACAGCCGTTGCGCAAGCAGTCTCCT
CGAAAAGACGCAGACTCGCTCTCAAGGAGGTTGACGTTGCCGACACCAAGACGGGGGGGTGGCCGAGGTATCATG
GGCAAGGCTCAGCGGCAGAGAGACAGCCGAGCAGGCGTCCTGCAGACTACGTTCAAGGCAATCAAGCGTGACGAT
ACACCGACCGAAGATGAGGTAGAGGAGCTCGATGCCGAGTTTCTGGCAGAACTCCCGGAAGACGTCCGGCAGGAA
GTCATGGCGGACCATCGACGCCGGCGAATGGCCCGTCGGTCAGGGCTGGAAGCGGCTGTACAGAGACAGCGAGTG
ACCGATGGCGACGGCTCGCTCCCCGGCGGACAGCGACGGATTCACTTCCCGGTGCCGCGGCCCAAGATCGCCTTT
AGCGGTGGAGTGACGTCGACGCCGGAGATCAAGACTATGCTGGATGGCTGGCACGACGAGACGCGCGATCAAGGC
CCTCACGGTGATGATGTGGAGGTGCTGGAGCGGTATCTGGCTCAGGTGGTGCTGGAAGAGGGTGACTTGCACAAG
GCGGTCATGTTGGTCAAGTGGCTGGACGTTCTGGTTGAGCAGGACGGGGGGGGCGCGGCTGGATGTGCGGCGTGG
AGGGAGGTGATGTGTCGGGTGAAGGGGGCGGTGCAGCAGGCTGTTGAGCAAAAGGGGTTGGCGCCTTTGAGTCTT
TGA
Transcript >Ophun1|3056
ATGGGCAGTGTTTTGGAGAAAAACTCATCGTCAGTGAGGAAGCGGATCGAGAAGCACTCGTTCGAAGACGAAGAT
GGCGAAGAGTACGAGGCCAGCAAGTTCCACGGCTTCGGCGACTACTTCCGGCGCAAAAAGATCAAGCTGCAGAAT
CTGGACGCCGAGACTCGGGCGGCGTCTGAGAAGCCCCAGATCTTCAAAGGCATTGTTGCTCATATTACAGGCTAC
ACGCAGCCCCCTCTTCACATACTCCATCGCGAGATTGTCCAGCATGGCGGGTGCTTCCTCCAATATCTCGACTCC
AAAACCATGGCGACGCACATCATTGCCTCGGCGTTGCCTCCCAAGAAGACTGTTGACTTTAGCCGCTACAGGATT
GTGAAGCCGACGTGGATCGTTGACTCGGTGAAAGCTGGGAAACTGCTCCCGTGGTCCGACTACCGCCTTGCAGAC
GAGGGCCCGCGGCAAAGGGTCTTGAAGCTGGACGGTGACAAGACTATCTCGCAGAAAAGCCCGCAGGCCAGACGG
GGCTACAGAGAGCAGACGGACAATAGCTTCTATACGAGCCAGATGAAAGCAACGGCAGCAACTCTGCCGAGTCAG
GGCCTGAGCCAAGTGGCGGAACAGCTGCTGACACCTGGCACCATCCAGTCAACGAGCCGGCCACTCGAACGGCAC
AAGATATATGGTACGAACAACAGGATTGATGGGTCCCCAACCGCCTCAAAACGCTCAGCCTCTAGTCCTTCCGAC
ATCTCGAAGCCTCCGCCGTCGGCTCAAACCCGGTCTCCCCCGTTGCCGTCCGATACATCGGCACCGACGGCTGAT
ACGACACCTACAAAGGCTATGACATCAGAGGAACACAACTCTTGGCTGCTCTCGGATCCACGGCTGCGCAAGTCG
TCGACGGCAAACCCCGACTTCCTCAAGCAATTCTACTCTGAGAGCAGGCTGCATCACCTCTCCACGTGGAAAGCC
AACCTCAAGTCGACGATGCAGCGACTGGCGGCGGAGAGAGGTCTCAACCAGGGCAAATCTAGACGACCTTCAGGA
GAAAGGAGATGTATTCTGCACGTCGACTTTGACAGCTTCTTCTGCGCTGTATCCCTCAAGAGACACCCAGAGCTC
GTCGACAAACCGACAGTCGTGGCTCACAGTCCAGGCCCAGGCTCCGAGATTGCAAGCTGCAACTATCCCGCTCGA
AAGTTTGGCGTCAAGAATGGCATGTGGATGAGGCGTGCCATGGAGCTGTGCCCCGATCTCAAGGTCTTGCCCTAC
GACTTTCCCGCTTACGAACAAGCCAGCCGACTATTCTACGAAGCCATCTTGGCCATCGGCGGCGTTGTTCAAAGT
GTAAGCGTGGATGAGGCCTTGATTGATGTGACTTCGGTCGTCTCGGAGGCCGGTGCCGATAAAGACACCGTCATG
AGAGAGCAACAAAAGGCCGACGAGCTGGCAACTTGGTTGAGACAACAGATCAAGACCAAGACAGGCTGCCACGTT
TCTGTCGGCATAGGCGGTAACATCCTGCAAGCCAAGGTTGCGTTGAGGAAAGCAAAGCCGGCAGGCCAATTTCAC
CTCAAGCCCGAGGATGTACTCGGAATCATCGGGGAGCTGAGAGTCGAGGAACTGCCAGGCGTCTCCTACAGCATC
GGCGGGAAGCTGGAGGAGCTGGGCGTCAGGCTCGTCAAGAACATACGGGAAGTGTCCAAAGACAGGCTGGCATCG
GCTCTGGGGCCCAAGACCGGGGAGAAGCTGGCCGACTACGCGCGAGGCATCGACCGGACAGAAGTCGGAGAGCAG
CCGCCTCGAAAGTCGGTGTCGGCAGAGGTCAACTGGGGCATCCGCTTCATCAGCCAGCAGGAAGCTGAGGAGTTT
GTGTACAACCTGTGCAAGGAGCTGGAAAAGCGACTGGTGAGCGAGCAGGTCAAGGGGAAACATCTCACCATGAAG
ATTATGAGGAGGTGTCTTGATGCTCCGCTGGATCCTACAAAGCATCTGGGCCACGGGAAATGCGACAGCTTCAAC
AAGAGCGCAACATTTGGCGTTGCCACGCACAATTACGACGTCATCGGCAAGGAGGCCGTCTCGATATTGCGGTCT
TTCAAGTTCAGCCCCGGTGACCTGAGAGGCCTCGGGGTCCAGATGACGAAGCTCGAACCGATCAAGATACAGGCG
AGAGCACCGGAAGGCAGTCAGCGGACCTTGACCTTTGGTGCCTTTGCAGGACCAGGCTCGGCGAAGAAGGCATCT
CGGCCGGAGCAGATTGACGATGTCGAAAGCCCAACGAAGCCGAGAGTCCCCGGAAACCGTGATATTGAAAAGGAC
CCCATCGCCGAGGATCCCGTGACGCCTCGAAAGCAGCATTTCCACCCGGCCATGGCTCTCTCGAGGGCGGCGCAG
GATGACGCAAAGGCAACGACTCCGTTGAACGTGTCGGGCACGCAGTTTCTCATCCCCAGCAATCCGGATCCCGCC
GTCATTGCGGAGCTGCCGTACGATATCCGGAGCAGGTTGATGAGCCAGCGAGCCAGATCCAGTCCGTCTCGCCCG
GTTCCTCGAACCGAAAGTCCCGTGGCCGCTGAAGTGCTTCCGTCTCAGGTCGATGCCCAAGTTTTCAACGCGCTG
CCGGATGATATGAAGGCTGAGGTGCTGGCCACTTACGGTCGTAAGCCAGCACAGCCGTTGCGCAAGCAGTCTCCT
CGAAAAGACGCAGACTCGCTCTCAAGGAGGTTGACGTTGCCGACACCAAGACGGGGGGGTGGCCGAGGTATCATG
GGCAAGGCTCAGCGGCAGAGAGACAGCCGAGCAGGCGTCCTGCAGACTACGTTCAAGGCAATCAAGCGTGACGAT
ACACCGACCGAAGATGAGGTAGAGGAGCTCGATGCCGAGTTTCTGGCAGAACTCCCGGAAGACGTCCGGCAGGAA
GTCATGGCGGACCATCGACGCCGGCGAATGGCCCGTCGGTCAGGGCTGGAAGCGGCTGTACAGAGACAGCGAGTG
ACCGATGGCGACGGCTCGCTCCCCGGCGGACAGCGACGGATTCACTTCCCGGTGCCGCGGCCCAAGATCGCCTTT
AGCGGTGGAGTGACGTCGACGCCGGAGATCAAGACTATGCTGGATGGCTGGCACGACGAGACGCGCGATCAAGGC
CCTCACGGTGATGATGTGGAGGTGCTGGAGCGGTATCTGGCTCAGGTGGTGCTGGAAGAGGGTGACTTGCACAAG
GCGGTCATGTTGGTCAAGTGGCTGGACGTTCTGGTTGAGCAGGACGGGGGGGGCGCGGCTGGATGTGCGGCGTGG
AGGGAGGTGATGTGTCGGGTGAAGGGGGCGGTGCAGCAGGCTGTTGAGCAAAAGGGGTTGGCGCCTTTGAGTCTT
TGA
Gene >Ophun1|3056
ATGGGCAGTGTTTTGGAGAAAAACTCATCGTCAGTGAGGAAGCGGATCGAGAAGCACTCGTTCGAAGACGAAGAT
GGCGAAGAGTACGAGGCCAGCAAGTTCCACGGCTTCGGCGACTACTTCCGGCGCAAAAAGATCAAGCTGCAGAAT
CTGGACGCCGAGACTCGGGCGGCGTCTGAGAAGCCCCAGATCTTCAAAGGCATTGTTGCTCATATTACAGGCTAC
ACGCAGCCCCCTCTTCACATGTGCGTTCGTCTTGTCCTCCGTTTCTGCCCGGCGCTGACACAGACGATAGACTCC
ATCGCGAGATTGTCCAGCATGGCGGGTGCTTCCTCCAATATCTCGACTCCAAAACCATGGCGACGCACATCATTG
CCTCGGCGTTGCCTCCCAAGAAGACTGTTGACTTTAGCCGCTACAGGATTGTGAAGCCGACGTGGATCGTTGACT
CGGTGAAAGCTGGGAAACTGCTCCCGTGGTCCGACTACCGCCTTGCAGACGAGGGCCCGCGGCAAAGGGTCTTGA
AGCTGGACGGTGACAAGACTATCTCGCAGAAAAGCCCGCAGGCCAGACGGGGCTACAGAGAGCAGACGGACAATA
GCTTCTATACGAGCCAGATGAAAGCAACGGCAGCAACTCTGCCGAGTCAGGGCCTGAGCCAAGTGGCGGAACAGC
TGCTGACACCTGGCACCATCCAGTCAACGAGCCGGCCACTCGAACGGCACAAGATATATGGTACGAACAACAGGA
TTGATGGGTCCCCAACCGCCTCAAAACGCTCAGCCTCTAGTCCTTCCGACATCTCGAAGCCTCCGCCGTCGGCTC
AAACCCGGTCTCCCCCGTTGCCGTCCGATACATCGGCACCGACGGCTGATACGACACCTACAAAGGCTATGACAT
CAGAGGAACACAACTCTTGGCTGCTCTCGGATCCACGGCTGCGCAAGTCGTCGACGGCAAACCCCGACTTCCTCA
AGCAATTCTACTCTGAGAGCAGGCTGCATCACCTCTCCACGTGGAAAGCCAACCTCAAGTCGACGATGCAGCGAC
TGGCGGCGGAGAGAGGTCTCAACCAGGGCAAATCTAGACGACCTTCAGGAGAAAGGAGATGTATTCTGCACGTCG
ACTTTGACAGCTTCTTCTGCGCTGTATCCCTCAAGAGACACCCAGAGCTCGTCGACAAACCGACAGTCGTGGCTC
ACAGTCCAGGCCCAGGCTCCGAGATTGCAAGCTGCAACTATCCCGCTCGAAAGTTTGGCGTCAAGAATGGCATGT
GGATGAGGCGTGCCATGGAGCTGTGCCCCGATCTCAAGGTCTTGCCCTACGACTTTCCCGCTTACGAACAAGCCA
GCCGACTATTCTACGAAGCCATCTTGGCCATCGGCGGCGTTGTTCAAAGTGTAAGCGTGGATGAGGCCTTGATTG
ATGTGACTTCGGTCGTCTCGGAGGCCGGTGCCGATAAAGACACCGTCATGAGAGAGCAACAAAAGGCCGACGAGC
TGGCAACTTGGTTGAGACAACAGATCAAGACCAAGACAGGCTGCCACGTTTCTGTCGGCATAGGCGGTAACATCC
TGCAAGCCAAGGTTGCGTTGAGGAAAGCAAAGCCGGCAGGCCAATTTCACCTCAAGCCCGAGGATGTACTCGGAA
TCATCGGGGAGCTGAGAGTCGAGGAACTGCCAGGCGTCTCCTACAGCATCGGCGGGAAGCTGGAGGAGCTGGGCG
TCAGGCTCGTCAAGAACATACGGGAAGTGTCCAAAGACAGGCTGGCATCGGCTCTGGGGCCCAAGACCGGGGAGA
AGCTGGCCGACTACGCGCGAGGCATCGACCGGACAGAAGTCGGAGAGCAGCCGCCTCGAAAGTCGGTGTCGGCAG
AGGTCAACTGGGGCATCCGCTTCATCAGCCAGCAGGAAGCTGAGGAGTTTGTGTACAACCTGTGCAAGGAGCTGG
AAAAGCGACTGGTGAGCGAGCAGGTCAAGGGGAAACATCTCACCATGAAGATTATGAGGAGGTGTCTTGATGCTC
CGCTGGATCCTACAAAGCATCTGGGCCACGGGAAATGCGACAGCTTCAACAAGAGCGCAACATTTGGCGTTGCCA
CGCACAATTACGACGTCATCGGCAAGGAGGCCGTCTCGATATTGCGGTCTTTCAAGTTCAGCCCCGGTGACCTGA
GAGGCCTCGGGGTCCAGATGACGAAGCTCGAACCGATCAAGATACAGGCGAGAGCACCGGAAGGCAGTCAGCGGA
CCTTGACCTTTGGTGCCTTTGCAGGACCAGGCTCGGCGAAGAAGGCATCTCGGCCGGAGCAGATTGACGATGTCG
AAAGCCCAACGAAGCCGAGAGTCCCCGGAAACCGTGATATTGAAAAGGACCCCATCGCCGAGGATCCCGTGACGC
CTCGAAAGCAGCATTTCCACCCGGCCATGGCTCTCTCGAGGGCGGCGCAGGATGACGCAAAGGCAACGACTCCGT
TGAACGTGTCGGGCACGCAGTTTCTCATCCCCAGCAATCCGGATCCCGCCGTCATTGCGGAGCTGCCGTACGATA
TCCGGAGCAGGTTGATGAGCCAGCGAGCCAGATCCAGTCCGTCTCGCCCGGTTCCTCGAACCGAAAGTCCCGTGG
CCGCTGAAGTGCTTCCGTCTCAGGTCGATGCCCAAGTTTTCAACGCGCTGCCGGATGATATGAAGGCTGAGGTGC
TGGCCACTTACGGTCGTAAGCCAGCACAGCCGTTGCGCAAGCAGTCTCCTCGAAAAGACGCAGACTCGCTCTCAA
GGAGGTTGACGTTGCCGACACCAAGACGGGGGGGTGGCCGAGGTATCATGGGCAAGGCTCAGCGGCAGAGAGACA
GCCGAGCAGGCGTCCTGCAGACTACGTTCAAGGCAATCAAGCGTGACGATACACCGACCGAAGATGAGGTAGAGG
AGCTCGATGCCGAGTTTCTGGCAGAACTCCCGGAAGACGTCCGGCAGGAAGTCATGGCGGACCATCGACGCCGGC
GAATGGCCCGTCGGTCAGGGCTGGAAGCGGCTGTACAGAGACAGCGAGTGACCGATGGCGACGGCTCGCTCCCCG
GCGGACAGCGACGGATTCACTTCCCGGTGCCGCGGCCCAAGATCGCCTTTAGCGGTGGAGTGACGTCGACGCCGG
AGATCAAGACTATGCTGGATGGCTGGCACGACGAGACGCGCGATCAAGGCCCTCACGGTGATGATGTGGAGGTGC
TGGAGCGGTATCTGGCTCAGGTGGTGCTGGAAGAGGGTGACTTGCACAAGGCGGTCATGTTGGTCAAGTGGCTGG
ACGTTCTGGTTGAGCAGGACGGGGGGGGCGCGGCTGGATGTGCGGCGTGGAGGGAGGTGATGTGTCGGGTGAAGG
GGGCGGTGCAGCAGGCTGTTGAGCAAAAGGGGTTGGCGCCTTTGAGTCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail