Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3050
Gene name
LocationContig_270:10516..11847
Strand+
Gene length (bp)1331
Transcript length (bp)1008
Coding sequence length (bp)1008
Protein length (aa) 336

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15906 zf-NOSIP Zinc-finger of nitric oxide synthase-interacting protein 4.4E-09 3 75
PF13445 zf-RING_UBOX RING-type zinc-finger 3.8E-05 269 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q21755|NOSIP_CAEEL Nitric oxide synthase-interacting protein homolog OS=Caenorhabditis elegans GN=R05G6.4 PE=3 SV=1 3 318 4.0E-19
sp|Q9D6T0|NOSIP_MOUSE Nitric oxide synthase-interacting protein OS=Mus musculus GN=Nosip PE=1 SV=1 3 318 2.0E-16
sp|Q55DU4|NOSIP_DICDI Nitric oxide synthase-interacting protein homolog OS=Dictyostelium discoideum GN=nosip PE=2 SV=1 3 122 7.0E-09
sp|Q9Y314|NOSIP_HUMAN Nitric oxide synthase-interacting protein OS=Homo sapiens GN=NOSIP PE=1 SV=1 3 84 1.0E-08
sp|Q4R7H4|NOSIP_MACFA Nitric oxide synthase-interacting protein OS=Macaca fascicularis GN=NOSIP PE=2 SV=1 3 84 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q21755|NOSIP_CAEEL Nitric oxide synthase-interacting protein homolog OS=Caenorhabditis elegans GN=R05G6.4 PE=3 SV=1 3 318 4.0E-19
sp|Q9D6T0|NOSIP_MOUSE Nitric oxide synthase-interacting protein OS=Mus musculus GN=Nosip PE=1 SV=1 3 318 2.0E-16
sp|Q55DU4|NOSIP_DICDI Nitric oxide synthase-interacting protein homolog OS=Dictyostelium discoideum GN=nosip PE=2 SV=1 3 122 7.0E-09
sp|Q9Y314|NOSIP_HUMAN Nitric oxide synthase-interacting protein OS=Homo sapiens GN=NOSIP PE=1 SV=1 3 84 1.0E-08
sp|Q4R7H4|NOSIP_MACFA Nitric oxide synthase-interacting protein OS=Macaca fascicularis GN=NOSIP PE=2 SV=1 3 84 1.0E-08
sp|Q3SWY5|NOSIP_BOVIN Nitric oxide synthase-interacting protein OS=Bos taurus GN=NOSIP PE=2 SV=1 3 84 2.0E-08
sp|Q5U3S7|NOSIP_DANRE Nitric oxide synthase-interacting protein OS=Danio rerio GN=nosip PE=2 SV=1 3 84 3.0E-08
sp|Q6P829|NOSIP_XENTR Nitric oxide synthase-interacting protein OS=Xenopus tropicalis GN=nosip PE=2 SV=1 3 84 3.0E-08
sp|Q55DU4|NOSIP_DICDI Nitric oxide synthase-interacting protein homolog OS=Dictyostelium discoideum GN=nosip PE=2 SV=1 203 293 1.0E-07
sp|Q6NUH3|NOSIP_XENLA Nitric oxide synthase-interacting protein OS=Xenopus laevis GN=nosip PE=2 SV=1 3 84 1.0E-07
sp|Q5U3S7|NOSIP_DANRE Nitric oxide synthase-interacting protein OS=Danio rerio GN=nosip PE=2 SV=1 203 318 2.0E-06
sp|Q6P829|NOSIP_XENTR Nitric oxide synthase-interacting protein OS=Xenopus tropicalis GN=nosip PE=2 SV=1 195 318 2.0E-06
sp|Q9Y314|NOSIP_HUMAN Nitric oxide synthase-interacting protein OS=Homo sapiens GN=NOSIP PE=1 SV=1 203 318 6.0E-06
sp|Q4R7H4|NOSIP_MACFA Nitric oxide synthase-interacting protein OS=Macaca fascicularis GN=NOSIP PE=2 SV=1 203 318 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3050
MSHSKRNTSRPVFTSHERAVAKSNWASSSARLNRDSFLPFGCCGLCLGSARDPVACLGGDIFCRECALANILAQK
KAIKRAEKANRFAEKEAAYAKTVEDEEDRKRTIRDFELTQAGLPADEKPRGAEVVEIDQRQEGGKSTAPVVVNKL
PEDVTEHDATAVVHVGTKRKFDLDDDEVRRVMKEDKRKARMAIEEEKAAKPTLPSFWTPSLTPDVQDSKLPPAPR
KEKTVPVCPSSSADDLHPISMQQLVTVHFHEEEGPSSQEKRRNCPSCLKALSNASSPVMTERCGHVLCMNCVKML
MPLAGKSAPEPDVPPIRRYQYKNPNRTATVLFEFA*
Coding >Ophun1|3050
ATGTCGCATAGTAAGCGAAACACGTCTCGACCCGTCTTCACCTCGCACGAGCGAGCAGTGGCCAAGTCCAACTGG
GCCTCGAGCTCGGCGCGCCTCAACCGCGATTCCTTCCTGCCCTTTGGCTGCTGCGGGCTTTGTCTTGGTTCCGCG
AGAGACCCGGTTGCGTGCCTCGGCGGCGACATCTTCTGTCGCGAATGTGCGCTCGCCAACATACTGGCGCAGAAG
AAAGCAATAAAGAGAGCGGAAAAAGCCAATCGCTTTGCGGAAAAGGAAGCCGCGTACGCCAAGACTGTCGAGGAT
GAGGAGGATCGCAAGAGGACAATCCGCGACTTTGAGCTGACGCAAGCCGGCCTCCCTGCTGATGAGAAGCCACGC
GGTGCAGAGGTCGTGGAGATAGATCAAAGGCAGGAGGGAGGGAAATCGACCGCGCCCGTCGTCGTCAACAAGCTG
CCAGAGGACGTCACAGAACATGATGCGACTGCTGTGGTTCATGTAGGCACGAAACGAAAGTTCGATTTGGACGAC
GATGAGGTGCGTCGAGTGATGAAGGAGGACAAACGAAAGGCGAGAATGGCAATCGAGGAAGAAAAAGCTGCCAAG
CCGACGTTGCCTAGCTTCTGGACGCCCTCTCTCACCCCGGATGTTCAAGACAGTAAACTGCCTCCGGCCCCCCGC
AAGGAGAAAACCGTGCCTGTCTGTCCCTCGTCCTCGGCAGATGACTTGCATCCCATTTCGATGCAGCAATTGGTG
ACGGTTCATTTTCACGAGGAAGAAGGCCCCTCAAGCCAAGAAAAGCGCCGAAACTGTCCTTCGTGTCTCAAGGCG
CTGTCCAACGCCTCTAGTCCAGTGATGACCGAGCGATGCGGCCATGTTCTCTGCATGAACTGCGTCAAGATGCTC
ATGCCGCTGGCCGGAAAGTCAGCGCCGGAACCAGACGTTCCCCCAATAAGAAGGTATCAATACAAGAATCCAAAC
CGAACGGCTACCGTGCTGTTCGAGTTCGCTTAG
Transcript >Ophun1|3050
ATGTCGCATAGTAAGCGAAACACGTCTCGACCCGTCTTCACCTCGCACGAGCGAGCAGTGGCCAAGTCCAACTGG
GCCTCGAGCTCGGCGCGCCTCAACCGCGATTCCTTCCTGCCCTTTGGCTGCTGCGGGCTTTGTCTTGGTTCCGCG
AGAGACCCGGTTGCGTGCCTCGGCGGCGACATCTTCTGTCGCGAATGTGCGCTCGCCAACATACTGGCGCAGAAG
AAAGCAATAAAGAGAGCGGAAAAAGCCAATCGCTTTGCGGAAAAGGAAGCCGCGTACGCCAAGACTGTCGAGGAT
GAGGAGGATCGCAAGAGGACAATCCGCGACTTTGAGCTGACGCAAGCCGGCCTCCCTGCTGATGAGAAGCCACGC
GGTGCAGAGGTCGTGGAGATAGATCAAAGGCAGGAGGGAGGGAAATCGACCGCGCCCGTCGTCGTCAACAAGCTG
CCAGAGGACGTCACAGAACATGATGCGACTGCTGTGGTTCATGTAGGCACGAAACGAAAGTTCGATTTGGACGAC
GATGAGGTGCGTCGAGTGATGAAGGAGGACAAACGAAAGGCGAGAATGGCAATCGAGGAAGAAAAAGCTGCCAAG
CCGACGTTGCCTAGCTTCTGGACGCCCTCTCTCACCCCGGATGTTCAAGACAGTAAACTGCCTCCGGCCCCCCGC
AAGGAGAAAACCGTGCCTGTCTGTCCCTCGTCCTCGGCAGATGACTTGCATCCCATTTCGATGCAGCAATTGGTG
ACGGTTCATTTTCACGAGGAAGAAGGCCCCTCAAGCCAAGAAAAGCGCCGAAACTGTCCTTCGTGTCTCAAGGCG
CTGTCCAACGCCTCTAGTCCAGTGATGACCGAGCGATGCGGCCATGTTCTCTGCATGAACTGCGTCAAGATGCTC
ATGCCGCTGGCCGGAAAGTCAGCGCCGGAACCAGACGTTCCCCCAATAAGAAGGTATCAATACAAGAATCCAAAC
CGAACGGCTACCGTGCTGTTCGAGTTCGCTTAG
Gene >Ophun1|3050
ATGTCGCATAGTGGGTTGCTTTCTCCCTTTCGGAGCCTCAACTACACCCGAACCAACTCGGAAACGCGCTGATAC
ATCTCGCAGGTAAGCGAAACACGTCTCGACCCGTCTTCACCTCGCACGAGCGAGCAGTGGCCAAGTCCAACTGGG
CCTCGAGCTCGGCGCGCCTCAACCGCGATTCCTTCCTGCCCTTTGGCTGCTGCGGGCTTTGTCTTGGTTCCGCGA
GAGACCCGGTTGCGTGCCTCGGCGGCGACATCTTCTGTCGCGAATGTGCGCTCGCCAACATACTGGCGCAGAAGA
AAGCAATAAAGAGAGCGGAAAAAGCCAATCGCTTTGCGGAAAAGGAAGCCGCGTACGCCAAGACTGTCGAGGATG
AGGAGGATCGCAAGAGGACAATCCGCGACTTTGAGCTGACGCAAGCCGGCCTCCCTGCTGATGAGAAGCCACGCG
GTGCAGAGGTCGTGGAGATAGATCAAAGGCAGGAGGGAGGGAAATCGACCGCGCCCGTCGTCGTCAACAAGCTGC
CAGAGGACGTCACAGAACATGATGCGACTGCTGTGGTTCATGTAGGCACGAAACGAAAGTTCGATTTGGACGACG
ATGAGGTGCGTCGAGTGATGAAGGAGGACAAACGAAAGGCGAGAATGGCAATCGAGGAAGAAAAAGTAAGTTGCT
TTCCCTCATCTAGCAGGCCTTGGTCTTTACTGACAGACTGCTCCAGGCTGCCAAGCCGACGTTGCCTAGCTTCTG
GACGCCCTCTCTCACCCCGGATGTTCAAGACAGTAAACTGCCTCCGGCCCCCCGCAAGGAGAAAACCGTGCCTGT
CTGTCCCTCGTCCTCGGCAGATGACTTGCATCCCATTTCGATGCAGCAATTGGTGACGGTTCATTTTCACGAGGA
AGAAGGCCCCTCAAGCCAAGAAAAGCGCCGAAACTGTCCTTCGTGTCTCAAGGCGCTGTCCAACGCCTCTAGTCC
AGTGATGACCGAGCGATGCGGCCATGTTCTCTGCATGAACTGCGTCAAGATGCTCATGCCGCTGGCCGGAAAGTC
AGCGCCGGAACCAGACGTTCCCCCAATGTGCTTCACATGCGACGCTCCCATTGCTTCCTCTACCTCCAACAAATC
ATCAAGATCAACCGGCCTGCTGCCAGCTGGAATCGTGGCGTTGAGGTCACAAGGCACAGGCTTTTCAGCGCGAGG
CTCTAACCAGGTAATGAAGTCCGGTACAGCGTTTCAATGTTGACGGGACATGACGTCCCCTGGTCTACAGAAGAA
GGTATCAATACAAGAATCCAAACCGAACGGCTACCGTGCTGTTCGAGTTCGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail