Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3049
Gene name
LocationContig_270:8979..10117
Strand-
Gene length (bp)1138
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01553 Acyltransferase Acyltransferase 8.5E-14 46 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06510|TAZ1_YEAST Lysophosphatidylcholine acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAZ1 PE=1 SV=1 5 330 7.0E-53
sp|Q16635|TAZ_HUMAN Tafazzin OS=Homo sapiens GN=TAZ PE=1 SV=1 9 290 1.0E-29
sp|Q6IV84|TAZ_PANTR Tafazzin OS=Pan troglodytes GN=TAZ PE=3 SV=1 9 290 2.0E-29
sp|Q6IV82|TAZ_PONPY Tafazzin OS=Pongo pygmaeus GN=TAZ PE=3 SV=1 9 288 5.0E-29
sp|Q6IV83|TAZ_GORGO Tafazzin OS=Gorilla gorilla gorilla GN=TAZ PE=3 SV=1 9 303 6.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06510|TAZ1_YEAST Lysophosphatidylcholine acyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAZ1 PE=1 SV=1 5 330 7.0E-53
sp|Q16635|TAZ_HUMAN Tafazzin OS=Homo sapiens GN=TAZ PE=1 SV=1 9 290 1.0E-29
sp|Q6IV84|TAZ_PANTR Tafazzin OS=Pan troglodytes GN=TAZ PE=3 SV=1 9 290 2.0E-29
sp|Q6IV82|TAZ_PONPY Tafazzin OS=Pongo pygmaeus GN=TAZ PE=3 SV=1 9 288 5.0E-29
sp|Q6IV83|TAZ_GORGO Tafazzin OS=Gorilla gorilla gorilla GN=TAZ PE=3 SV=1 9 303 6.0E-29
sp|Q6IV77|TAZ_MACMU Tafazzin OS=Macaca mulatta GN=TAZ PE=2 SV=1 9 303 4.0E-28
sp|Q6IV78|TAZ_SAISC Tafazzin OS=Saimiri sciureus GN=TAZ PE=3 SV=1 9 303 5.0E-28
sp|Q6IV76|TAZ_ERYPA Tafazzin OS=Erythrocebus patas GN=TAZ PE=2 SV=1 9 303 5.0E-28
sp|Q54DX7|TAZ1_DICDI Putative lysophosphatidylcholine acyltransferase OS=Dictyostelium discoideum GN=taz PE=3 SV=1 12 303 8.0E-27
sp|Q9ZV87|NAPES_ARATH N-acylphosphatidylethanolamine synthase OS=Arabidopsis thaliana GN=At1g78690 PE=2 SV=1 17 300 2.0E-26
sp|Q9V6G5|TAZ_DROME Tafazzin homolog OS=Drosophila melanogaster GN=Taz PE=2 SV=2 8 256 2.0E-25
[Show less]

GO

GO Term Description Terminal node
GO:0016746 acyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3049
MRGPPRRSLTWQLASRSVMCTAGLIARSFLYGLNRVEVTGLHHLLGALDRRKREGPKRGLLTVCNHLAVLDDPLI
WGILPLRYTTDPQNLRWSLGAHDICFKNSLLSTFFRLGQVLPTRRLWHSPVGGLYQPTMTQAIGLLSGPDKAPIC
SDPFFSTDGTDSFPAPAAYAANRNAWVHVFPEACCHQSPDSGLRYFKWGISRLILESEPAPEFLPMFIHGTQAIM
PEDRGWPQWLPRIGNHVRVVIGELREVDDLFGRQRASWKLLADRSDAEHLQTSPEAVQLRVELARSARSQVETLR
ESIGLPRETDDTACLAQSWSKDPNKRRNSSIDGSSVNQP*
Coding >Ophun1|3049
ATGCGCGGTCCGCCTCGCCGCAGCCTCACCTGGCAGCTGGCATCCAGGTCTGTGATGTGCACCGCCGGCCTCATC
GCCAGAAGCTTCCTATATGGCTTGAATCGCGTCGAAGTCACGGGTCTACATCATCTTCTGGGAGCACTCGACCGG
CGAAAAAGAGAGGGTCCGAAGCGCGGCTTGCTGACTGTCTGCAACCACCTCGCTGTACTCGATGACCCTCTGATA
TGGGGTATCCTTCCCTTGCGATACACCACGGATCCTCAGAACCTGAGGTGGAGCCTCGGTGCTCACGATATATGC
TTCAAGAATAGTCTTCTTTCTACCTTCTTCAGGCTCGGACAAGTCTTGCCCACCCGTCGTTTGTGGCATTCGCCT
GTAGGCGGGCTTTACCAGCCGACCATGACACAAGCTATCGGTCTCCTCTCTGGCCCTGACAAAGCACCCATCTGT
TCAGATCCGTTCTTCTCGACCGACGGAACCGATTCGTTTCCTGCGCCTGCTGCATACGCTGCCAATCGAAATGCT
TGGGTCCACGTCTTTCCCGAAGCCTGCTGTCACCAAAGCCCAGACAGCGGCCTTCGATACTTCAAATGGGGCATC
TCTCGGCTTATCCTCGAAAGTGAACCTGCCCCTGAATTCTTACCCATGTTTATTCACGGGACTCAGGCGATTATG
CCCGAGGATAGGGGGTGGCCACAATGGCTTCCACGCATTGGGAACCACGTCAGGGTGGTTATCGGGGAGTTGCGG
GAGGTTGATGATTTGTTTGGACGTCAGCGCGCGTCGTGGAAGCTTCTGGCTGACCGTAGCGACGCAGAGCACCTC
CAAACCAGCCCGGAGGCCGTTCAGTTGCGAGTTGAGTTGGCCAGGTCAGCGCGAAGCCAAGTCGAGACGTTGCGA
GAGAGTATTGGCTTGCCTCGCGAAACGGATGATACGGCATGTCTTGCACAGAGTTGGTCCAAGGACCCAAATAAG
CGCAGGAACAGTTCCATCGATGGAAGTTCTGTCAATCAGCCCTGA
Transcript >Ophun1|3049
ATGCGCGGTCCGCCTCGCCGCAGCCTCACCTGGCAGCTGGCATCCAGGTCTGTGATGTGCACCGCCGGCCTCATC
GCCAGAAGCTTCCTATATGGCTTGAATCGCGTCGAAGTCACGGGTCTACATCATCTTCTGGGAGCACTCGACCGG
CGAAAAAGAGAGGGTCCGAAGCGCGGCTTGCTGACTGTCTGCAACCACCTCGCTGTACTCGATGACCCTCTGATA
TGGGGTATCCTTCCCTTGCGATACACCACGGATCCTCAGAACCTGAGGTGGAGCCTCGGTGCTCACGATATATGC
TTCAAGAATAGTCTTCTTTCTACCTTCTTCAGGCTCGGACAAGTCTTGCCCACCCGTCGTTTGTGGCATTCGCCT
GTAGGCGGGCTTTACCAGCCGACCATGACACAAGCTATCGGTCTCCTCTCTGGCCCTGACAAAGCACCCATCTGT
TCAGATCCGTTCTTCTCGACCGACGGAACCGATTCGTTTCCTGCGCCTGCTGCATACGCTGCCAATCGAAATGCT
TGGGTCCACGTCTTTCCCGAAGCCTGCTGTCACCAAAGCCCAGACAGCGGCCTTCGATACTTCAAATGGGGCATC
TCTCGGCTTATCCTCGAAAGTGAACCTGCCCCTGAATTCTTACCCATGTTTATTCACGGGACTCAGGCGATTATG
CCCGAGGATAGGGGGTGGCCACAATGGCTTCCACGCATTGGGAACCACGTCAGGGTGGTTATCGGGGAGTTGCGG
GAGGTTGATGATTTGTTTGGACGTCAGCGCGCGTCGTGGAAGCTTCTGGCTGACCGTAGCGACGCAGAGCACCTC
CAAACCAGCCCGGAGGCCGTTCAGTTGCGAGTTGAGTTGGCCAGGTCAGCGCGAAGCCAAGTCGAGACGTTGCGA
GAGAGTATTGGCTTGCCTCGCGAAACGGATGATACGGCATGTCTTGCACAGAGTTGGTCCAAGGACCCAAATAAG
CGCAGGAACAGTTCCATCGATGGAAGTTCTGTCAATCAGCCCTGA
Gene >Ophun1|3049
ATGCGCGGTCCGCCTCGCCGCAGCCTCACCTGGCAGCTGGCATCCAGGTCTGTGATGTGCACCGCCGGCCTCATC
GCCAGAAGCTTCCTATATGGCTTGAATCGCGTCGAAGTCACGGGTCTACATCATCTTCTGGGAGCACTCGACCGG
CGAAAAAGAGAGGGTCCGAAGCGCGGCTTGCTGACTGTCTGCAACCACCTCGCTGTGTACGGTTTGGCTGCCTTG
ATTGCCTTTTTTTGGAACTCGCTGAGACTGAGACTTCTTGCAGACTCGATGACCCTCTGATATGGGGTATCCTTC
CCTTGCGATACACCACGGATCCTCAGAACCTGAGGTGGAGCCTCGGTGCTCACGATATATGCTTCAAGAATAGGT
CTGTCTCACGCGTTGCAGTTCGCCGCTCATGCATCTTGACTGACCCTTCATCAGTCTTCTTTCTACCTTCTTCAG
GCTCGGACAAGTCTTGCCCACCCGTCGTTTGTGGCATTCGCCTGTAGGCGGGCTTTACCAGCCGACCATGACACA
AGCTATCGGTCTCCTCTCTGGCCCTGACAAAGCACCCATCTGTTCAGATCCGTTCTTCTCGACCGACGGAACCGA
TTCGTTTCCTGCGCCTGCTGCATACGCTGCCAATCGAAATGCTTGGGTCCACGTCTTTCCCGAAGCCTGCTGTCA
CCAAAGCCCAGACAGCGGCCTTCGATACTTCAAATGGGGCATCTCTCGGCTTATCCTCGAAAGTGAACCTGCCCC
TGAATTCTTACCCATGTTTATTCACGGGACTCAGGCGATTATGCCCGAGGATAGGGGGTGGCCACAATGGCTTCC
ACGCATTGGGAACCACGTCAGGGTGGTTATCGGGGAGTTGCGGGAGGTTGATGATTTGTTTGGACGTCAGCGCGC
GTCGTGGAAGCTTCTGGCTGACCGTAGCGACGCAGAGCACCTCCAAACCAGCCCGGAGGCCGTTCAGTTGCGAGT
TGAGTTGGCCAGGTCAGCGCGAAGCCAAGTCGAGACGTTGCGAGAGAGTATTGGCTTGCCTCGCGAAACGGATGA
TACGGCATGTCTTGCACAGAGTTGGTCCAAGGACCCAAATAAGCGCAGGAACAGTTCCATCGATGGAAGTTCTGT
CAATCAGCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail