Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3045
Gene name
LocationContig_270:624..2822
Strand+
Gene length (bp)2198
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04928 PAP_central Poly(A) polymerase central domain 8.9E-110 8 356
PF04926 PAP_RNA-bind Poly(A) polymerase predicted RNA binding domain 2.9E-51 358 505
PF01909 NTP_transf_2 Nucleotidyltransferase domain 1.2E-08 82 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10295|PAP_SCHPO Poly(A) polymerase pla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pla1 PE=1 SV=1 7 520 0.0E+00
sp|P29468|PAP_YEAST Poly(A) polymerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP1 PE=1 SV=1 1 516 3.0E-165
sp|Q9UW26|PAPA_CANAL Poly(A) polymerase PAPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPA PE=3 SV=1 3 534 1.0E-162
sp|O42617|PAP_CANAL Poly(A) polymerase PAPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPALPHA PE=3 SV=1 5 519 7.0E-162
sp|Q9BWT3|PAPOG_HUMAN Poly(A) polymerase gamma OS=Homo sapiens GN=PAPOLG PE=1 SV=2 7 427 1.0E-118
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10295|PAP_SCHPO Poly(A) polymerase pla1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pla1 PE=1 SV=1 7 520 0.0E+00
sp|P29468|PAP_YEAST Poly(A) polymerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAP1 PE=1 SV=1 1 516 3.0E-165
sp|Q9UW26|PAPA_CANAL Poly(A) polymerase PAPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPA PE=3 SV=1 3 534 1.0E-162
sp|O42617|PAP_CANAL Poly(A) polymerase PAPalpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAPALPHA PE=3 SV=1 5 519 7.0E-162
sp|Q9BWT3|PAPOG_HUMAN Poly(A) polymerase gamma OS=Homo sapiens GN=PAPOLG PE=1 SV=2 7 427 1.0E-118
sp|Q6PCL9|PAPOG_MOUSE Poly(A) polymerase gamma OS=Mus musculus GN=Papolg PE=1 SV=1 4 408 2.0E-118
sp|Q54J73|PAP_DICDI Poly(A) polymerase OS=Dictyostelium discoideum GN=papA PE=3 SV=1 6 427 1.0E-112
sp|Q9WVP6|PAPOB_MOUSE Poly(A) polymerase beta OS=Mus musculus GN=Papolb PE=1 SV=2 7 425 5.0E-112
sp|Q9NRJ5|PAPOB_HUMAN Poly(A) polymerase beta OS=Homo sapiens GN=PAPOLB PE=2 SV=1 7 408 1.0E-111
sp|Q61183|PAPOA_MOUSE Poly(A) polymerase alpha OS=Mus musculus GN=Papola PE=1 SV=4 7 414 3.0E-109
sp|P51003|PAPOA_HUMAN Poly(A) polymerase alpha OS=Homo sapiens GN=PAPOLA PE=1 SV=4 7 408 4.0E-109
sp|P25500|PAPOA_BOVIN Poly(A) polymerase alpha OS=Bos taurus GN=PAPOLA PE=1 SV=3 7 414 4.0E-109
sp|P51004|PAPO1_XENLA Poly(A) polymerase alpha-A (Fragment) OS=Xenopus laevis GN=papola-a PE=2 SV=1 5 414 1.0E-108
sp|O82312|PAPS2_ARATH Nuclear poly(A) polymerase 2 OS=Arabidopsis thaliana GN=PAPS2 PE=1 SV=2 7 399 4.0E-102
sp|Q8VYW1|PAPS4_ARATH Nuclear poly(A) polymerase 4 OS=Arabidopsis thaliana GN=PAPS4 PE=1 SV=1 1 399 3.0E-100
sp|Q9LMT2|PAPS1_ARATH Nuclear poly(A) polymerase 1 OS=Arabidopsis thaliana GN=PAPS1 PE=1 SV=1 5 408 3.0E-100
sp|P51006|PAPO3_XENLA Poly(A) polymerase type 3 (Fragment) OS=Xenopus laevis PE=2 SV=1 3 366 3.0E-100
sp|Q56XM9|PAPS3_ARATH Nuclear poly(A) polymerase 3 OS=Arabidopsis thaliana GN=PAPS3 PE=1 SV=1 17 399 8.0E-50
sp|P51005|PAPO2_XENLA Poly(A) polymerase alpha-B OS=Xenopus laevis GN=papola-b PE=2 SV=1 243 414 3.0E-43
sp|Q51D88|PAP_ENTHI Poly(A) polymerase OS=Entamoeba histolytica GN=16.t00038 PE=2 SV=1 85 414 5.0E-38
[Show less]

GO

GO Term Description Terminal node
GO:0004652 polynucleotide adenylyltransferase activity Yes
GO:0016779 nucleotidyltransferase activity Yes
GO:0043631 RNA polyadenylation Yes
GO:0003723 RNA binding Yes
GO:0044237 cellular metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008152 metabolic process No
GO:0070566 adenylyltransferase activity No
GO:0097159 organic cyclic compound binding No
GO:0016740 transferase activity No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0003676 nucleic acid binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5352
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5197
Ophiocordyceps australis map64 (Brazil) OphauB2|4597
Ophiocordyceps camponoti-floridani Ophcf2|05641
Ophiocordyceps camponoti-rufipedis Ophun1|3045 (this protein)
Ophiocordyceps kimflemingae Ophio5|1936
Ophiocordyceps subramaniannii Hirsu2|5222

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3045
MSGEQVFGVTPPISVTLPTDLEKRSSDALIEELRRQKTFESPSDTQKRYKVLESLQSICDEFVKRVARDKEPKND
MLIKNARGKVFTYGSFRLGVFGPGSDIDTLIVAPKYVTRDDYFKLFPDLLVEMAPKGAITDLTVVTEAFVPIIKF
EYSGISIDLIFSRIVQKQLSASFQDLKDSALLRGLDEAELRSLNGTRVTDEILNLVPEQSTFKLALRAIKLWAQR
RAVYANIMGFPGGVAWAMLVARVCQLYPKAATSVIVNKFFLVIGQWRWPHPVLLKPIESGPLPVRVWNPKIYKGD
TFHLMPVITPAYPSMCATFNITRSSMAVINRELQRGLKLTENIMVGKSPWSDLFVKHTFFTSDYRYYISVISAAK
DKEAHKIWSGYVESKVRMLVQKLELHPSIALAHAFNKGYDRRHRCKDDQQIAQVQEGCLDYMISADDVTKEVDSG
RDVAKTDDDSEPAPFTEVFTTTHYIGIQLVDKAKSLDLSFQVDEFKSLCTQWKSFKLPDDVFEAGEKKPQKKGIK
RPPMAEKRGPSEGVSQWDQATITFALDEQRLYKARPHRSPQKTFLRY*
Coding >Ophun1|3045
ATGTCTGGAGAGCAGGTGTTCGGCGTCACGCCACCCATCTCTGTTACACTCCCTACAGACTTGGAGAAGCGATCC
AGCGATGCTTTGATCGAGGAGCTGCGTCGGCAGAAGACGTTCGAGAGCCCGTCCGATACTCAAAAGAGATACAAG
GTCCTCGAATCATTGCAGTCCATCTGCGACGAATTTGTCAAACGGGTTGCGAGGGACAAAGAGCCCAAGAACGAC
ATGTTAATTAAGAACGCTCGGGGCAAGGTATTCACCTACGGAAGCTTCAGGCTGGGAGTCTTTGGTCCCGGCTCT
GACATCGACACGCTCATCGTCGCTCCCAAATATGTTACACGAGACGACTACTTCAAATTATTCCCGGACTTGCTG
GTCGAAATGGCCCCAAAAGGCGCCATCACAGATCTCACTGTCGTCACCGAAGCCTTCGTGCCCATCATCAAGTTC
GAATATTCCGGCATAAGTATCGATTTGATTTTTTCCCGCATTGTGCAGAAGCAGCTTTCAGCTAGTTTCCAGGAT
CTGAAGGACTCGGCCCTTCTCCGAGGCTTGGACGAGGCTGAGCTGCGGTCACTCAACGGCACTCGGGTGACAGAC
GAGATACTGAATCTTGTGCCTGAGCAAAGTACTTTCAAGCTGGCCTTGCGCGCTATCAAGTTATGGGCTCAGCGC
CGTGCCGTTTATGCCAACATTATGGGTTTTCCCGGCGGCGTGGCCTGGGCTATGCTGGTAGCTCGAGTGTGCCAG
CTGTACCCGAAGGCGGCCACCTCCGTTATTGTCAACAAATTCTTTCTCGTCATTGGGCAGTGGCGGTGGCCACAT
CCTGTTCTCCTCAAACCCATCGAGAGTGGTCCCCTTCCAGTTCGCGTCTGGAATCCGAAGATCTACAAAGGTGAC
ACTTTCCACCTCATGCCGGTCATCACTCCAGCGTATCCGTCGATGTGTGCCACCTTCAACATCACTCGCTCTTCT
ATGGCGGTCATCAACAGAGAGCTTCAGCGCGGCTTAAAACTGACGGAAAACATTATGGTTGGCAAGAGTCCATGG
AGCGATCTTTTCGTCAAGCACACATTCTTCACGTCGGATTACAGATACTATATATCCGTCATTTCAGCCGCCAAG
GACAAAGAAGCTCACAAAATATGGTCGGGCTACGTCGAGTCCAAAGTCCGCATGCTAGTACAGAAACTCGAGTTG
CACCCATCCATAGCCTTAGCTCACGCCTTCAACAAAGGCTACGACAGGCGTCATCGTTGCAAAGACGATCAACAA
ATTGCCCAAGTGCAGGAAGGCTGTCTCGACTACATGATAAGCGCCGATGACGTGACCAAGGAAGTGGACAGCGGC
CGAGATGTTGCGAAGACTGACGACGATTCGGAGCCTGCCCCGTTTACCGAGGTCTTCACAACTACTCATTACATC
GGAATTCAACTTGTAGACAAGGCAAAGTCACTGGATTTGTCCTTCCAGGTGGACGAGTTCAAATCCCTCTGCACT
CAATGGAAAAGTTTCAAGCTTCCCGACGACGTCTTCGAGGCGGGCGAAAAGAAGCCGCAGAAGAAGGGTATCAAG
CGGCCACCGATGGCAGAGAAGCGTGGCCCGTCAGAGGGCGTTTCTCAATGGGACCAGGCGACAATCACTTTTGCT
CTTGACGAGCAACGCCTCTACAAGGCTCGGCCCCATCGGAGCCCCCAGAAAACGTTTCTCCGATACTGA
Transcript >Ophun1|3045
ATGTCTGGAGAGCAGGTGTTCGGCGTCACGCCACCCATCTCTGTTACACTCCCTACAGACTTGGAGAAGCGATCC
AGCGATGCTTTGATCGAGGAGCTGCGTCGGCAGAAGACGTTCGAGAGCCCGTCCGATACTCAAAAGAGATACAAG
GTCCTCGAATCATTGCAGTCCATCTGCGACGAATTTGTCAAACGGGTTGCGAGGGACAAAGAGCCCAAGAACGAC
ATGTTAATTAAGAACGCTCGGGGCAAGGTATTCACCTACGGAAGCTTCAGGCTGGGAGTCTTTGGTCCCGGCTCT
GACATCGACACGCTCATCGTCGCTCCCAAATATGTTACACGAGACGACTACTTCAAATTATTCCCGGACTTGCTG
GTCGAAATGGCCCCAAAAGGCGCCATCACAGATCTCACTGTCGTCACCGAAGCCTTCGTGCCCATCATCAAGTTC
GAATATTCCGGCATAAGTATCGATTTGATTTTTTCCCGCATTGTGCAGAAGCAGCTTTCAGCTAGTTTCCAGGAT
CTGAAGGACTCGGCCCTTCTCCGAGGCTTGGACGAGGCTGAGCTGCGGTCACTCAACGGCACTCGGGTGACAGAC
GAGATACTGAATCTTGTGCCTGAGCAAAGTACTTTCAAGCTGGCCTTGCGCGCTATCAAGTTATGGGCTCAGCGC
CGTGCCGTTTATGCCAACATTATGGGTTTTCCCGGCGGCGTGGCCTGGGCTATGCTGGTAGCTCGAGTGTGCCAG
CTGTACCCGAAGGCGGCCACCTCCGTTATTGTCAACAAATTCTTTCTCGTCATTGGGCAGTGGCGGTGGCCACAT
CCTGTTCTCCTCAAACCCATCGAGAGTGGTCCCCTTCCAGTTCGCGTCTGGAATCCGAAGATCTACAAAGGTGAC
ACTTTCCACCTCATGCCGGTCATCACTCCAGCGTATCCGTCGATGTGTGCCACCTTCAACATCACTCGCTCTTCT
ATGGCGGTCATCAACAGAGAGCTTCAGCGCGGCTTAAAACTGACGGAAAACATTATGGTTGGCAAGAGTCCATGG
AGCGATCTTTTCGTCAAGCACACATTCTTCACGTCGGATTACAGATACTATATATCCGTCATTTCAGCCGCCAAG
GACAAAGAAGCTCACAAAATATGGTCGGGCTACGTCGAGTCCAAAGTCCGCATGCTAGTACAGAAACTCGAGTTG
CACCCATCCATAGCCTTAGCTCACGCCTTCAACAAAGGCTACGACAGGCGTCATCGTTGCAAAGACGATCAACAA
ATTGCCCAAGTGCAGGAAGGCTGTCTCGACTACATGATAAGCGCCGATGACGTGACCAAGGAAGTGGACAGCGGC
CGAGATGTTGCGAAGACTGACGACGATTCGGAGCCTGCCCCGTTTACCGAGGTCTTCACAACTACTCATTACATC
GGAATTCAACTTGTAGACAAGGCAAAGTCACTGGATTTGTCCTTCCAGGTGGACGAGTTCAAATCCCTCTGCACT
CAATGGAAAAGTTTCAAGCTTCCCGACGACGTCTTCGAGGCGGGCGAAAAGAAGCCGCAGAAGAAGGGTATCAAG
CGGCCACCGATGGCAGAGAAGCGTGGCCCGTCAGAGGGCGTTTCTCAATGGGACCAGGCGACAATCACTTTTGCT
CTTGACGAGCAACGCCTCTACAAGGCTCGGCCCCATCGGAGCCCCCAGAAAACGTTTCTCCGATACTGA
Gene >Ophun1|3045
ATGTCTGGAGAGCAGGTGTTCGGCGTCACGCCACCCATCTCTGTTACACTCCCTACAGACTTGGAGAAGCGATCC
AGCGATGCTTTGATCGAGGAGCTGCGTCGGCAGAAGACGTTCGAGAGCCCGTCCGATACTCAAAAGAGGTAGCTA
CTTTTTTCTTCTGTCGCCCATCAAAGCTGTATTACTCTGGCTCTAACAATCGTTTCACAGATACAAGGTCCTCGA
ATCATTGCAGTCCATCTGCGACGAATTTGTCAAACGGGTTGCGAGGGACAAAGAGCCCAAGAACGACATGTTAAT
TAAGAACGCTCGGGGCAAGGTATTCACCTACGGAAGCTTCAGGCTGGGAGTCTTTGGTCCCGGCTCTGACATCGA
CACGCTCATCGTCGCTCCCAAATATGTTACACGAGACGACTACTTCAAATTATTCCCGGACTTGCTGGTCGAAAT
GGCCCCAAAAGGCGCCATCACAGATCTCACTGTCGTCACCGAAGCCTTCGTGCCCATCATCAAGTTCGAATATTC
CGGCATAAGTATCGATTTGATTTTTTCCCGCATTGTGCAGAAGCAGCTTTCAGCTAGTTTCCAGGATCTGAAGGA
CTCGGCCCTTCTCCGAGGCTTGGACGAGGCTGAGCTGCGGTCACTCAACGGCACTCGGGTGACAGACGAGATACT
GAATCTTGTGCCTGAGCAAAGTACTTTCAAGCTGGCCTTGCGCGCTATCAAGTTATGGGCTCAGCGCCGTGCCGT
TTATGCCAACATTATGGGTTTTCCCGGCGGCGTGGCCTGGGCTATGCTGGTAGCTCGAGTGTGCCAGCTGTACCC
GAAGGCGGCCACCTCCGTTATTGTCAACAAATTCTTTCTCGTCATTGGGCAGTGGCGGTGGCCACATCCTGTTCT
CCTCAAACCCATCGAGAGTGGTCCCCTTCCAGTTCGCGTCTGGAATCCGAAGGTGAGTTCCCTTTTCCCGTGTTG
AAATGTCTAACCCATTGACGATCCGTCAGATCTACAAAGGTGACACTTTCCACCTCATGCCGGTCATCACTCCAG
CGTATCCGTCGATGTGTGCCACCTTCAACATCACTCGCTCTTCTATGGCGGTCATCAACAGAGAGCTTCAGCGCG
GCTTAAAACTGACGGAAAACATTATGGTTGGCAAGAGTCCATGGAGCGATCTTTTCGTCAAGCACACATTCTTCA
CGTCGGATTACAGATACTATATATCCGTCATTTCAGCCGCCAAGGACAAAGAAGCTCACAAAATATGGTCGGGCT
ACGTCGAGTCCAAAGTCCGCATGCTAGTACAGAAACTCGAGTTGCACCCATCCATAGCCTTAGCTCACGCCTTCA
ACAAAGGCTACGACAGGCGTCATCGTTGCAAAGACGATCAACAAATTGCCCAAGTGCAGGAAGGCTGTCTCGACT
ACATGATAAGCGCCGATGACGTGACCAAGGAAGTGGACAGCGGCCGAGATGTTGCGAAGACTGACGACGATTCGG
AGCCTGCCCCGTTTACCGAGGTCTTCACAACTACTCATTACATCGGAATTCAACTTGTAGACAGTGAGTGGTCCT
TGCGAAATGTCCAGCAGCAGAATAAGCTGTGAGTTGAAGGTAAAGCTGACTTTGGCATCATAGAGGCAAAGTCAC
TGGATTTGTCCTTCCAGGTGGACGAGTTCAAATCCCTCTGCACTCAATGGAAAAGGTTCCAAGACGATCTACGTA
CCTTGGTCTCCATCGGCGTTCAGCACGTGCGAAAGTAAACCACAATCTGCTACCCCGGTCGAAGAAGTATGTTGG
CTGACGGCGCACGCAGTTTCAAGCTTCCCGACGACGTCTTCGAGGCGGGCGAAAAGAAGCCGCAGAAGAAGGGTA
TCAAGCGGCCACCGATGGCAGAGAAGCGTGGCCCGTCAGAGGTAAGTATCCCAACGGAAATCATATAGTGGCGGG
CAGATATCGGCGGATTCGTTGGATATAATGACCCAGCATTGACTGTTTGGCAGGACAACGCTCCGCCGCCGGCGA
AGAGACACCAGACCTCCGTGGTCGCTGCCGGCTGAACATCATTTTTTGGATCTGACTCGGCACAGGGCGTTTCTC
AATGGGACCAGGCGACAATCACTTTTGCTCTTGACGAGCAACGCCTCTACAAGGCTCGGCCCCATCGGAGCCCCC
AGAAAACGTTTCTCCGATACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail