Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3043
Gene name
LocationContig_27:49316..53175
Strand+
Gene length (bp)3859
Transcript length (bp)3678
Coding sequence length (bp)3678
Protein length (aa) 1226

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 1.2E-70 99 444

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 29 1203 0.0E+00
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 20 1058 0.0E+00
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 21 960 0.0E+00
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 29 1038 2.0E-150
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 28 938 8.0E-108
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 29 1203 0.0E+00
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 20 1058 0.0E+00
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 21 960 0.0E+00
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 29 1038 2.0E-150
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 28 938 8.0E-108
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 178 951 1.0E-103
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 190 932 3.0E-103
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 178 951 3.0E-103
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 178 951 5.0E-103
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 178 951 4.0E-102
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 190 932 4.0E-100
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 190 932 2.0E-99
sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 94 610 4.0E-53
sp|Q9NTJ5|SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens GN=SACM1L PE=1 SV=2 94 610 2.0E-52
sp|Q5R921|SAC1_PONAB Phosphatidylinositide phosphatase SAC1 OS=Pongo abelii GN=SACM1L PE=2 SV=1 94 610 2.0E-52
sp|P32019|I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens GN=INPP5B PE=1 SV=4 627 951 9.0E-52
sp|Q8K337|I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus GN=Inpp5b PE=1 SV=1 627 943 1.0E-51
sp|Q9EP69|SAC1_MOUSE Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=1 SV=1 94 610 1.0E-51
sp|Q01968|OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL-1 OS=Homo sapiens GN=OCRL PE=1 SV=3 632 961 2.0E-51
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 96 610 4.0E-51
sp|A1L244|SAC1A_DANRE Phosphatidylinositide phosphatase SAC1-A OS=Danio rerio GN=sacm1la PE=2 SV=1 94 610 9.0E-51
sp|D3ZGS3|OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL-1 OS=Rattus norvegicus GN=Ocrl PE=1 SV=1 632 961 1.0E-50
sp|Q6NVF0|OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL-1 OS=Mus musculus GN=Ocrl PE=1 SV=1 632 961 4.0E-50
sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 96 610 1.0E-48
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 193 610 5.0E-47
sp|A4VCH0|SAC1B_DANRE Phosphatidylinositide phosphatase SAC1-B OS=Danio rerio GN=sacm1lb PE=2 SV=2 96 610 4.0E-46
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 190 602 4.0E-46
sp|P32368|SAC1_YEAST Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC1 PE=1 SV=1 194 610 1.0E-45
sp|Q9W0I6|SAC1_DROME Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=2 SV=1 80 611 4.0E-44
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 193 610 7.0E-44
sp|Q9C5G5|SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana GN=SAC7 PE=2 SV=1 189 610 2.0E-43
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 624 994 4.0E-42
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 193 610 4.0E-42
sp|Q7X911|SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana GN=SAC6 PE=2 SV=1 292 610 5.0E-42
sp|Q0WT19|IP5P8_ARATH Type I inositol polyphosphate 5-phosphatase 8 OS=Arabidopsis thaliana GN=IP5P8 PE=2 SV=1 645 948 7.0E-41
sp|Q96328|SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana GN=SAC8 PE=2 SV=1 190 611 6.0E-40
sp|O60162|YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.03 PE=1 SV=1 189 612 8.0E-39
sp|O14127|YF51_SCHPO Uncharacterized protein C3C7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.01c PE=3 SV=2 176 610 3.0E-35
sp|Q8GTS0|IP5P4_ARATH Type I inositol polyphosphate 5-phosphatase 4 OS=Arabidopsis thaliana GN=IP5P4 PE=2 SV=1 725 951 1.0E-34
sp|Q9LR47|IP5P6_ARATH Type IV inositol polyphosphate 5-phosphatase 6 OS=Arabidopsis thaliana GN=IP5P6 PE=1 SV=2 725 950 2.0E-34
sp|Q0WQ41|IP5P7_ARATH Type IV inositol polyphosphate 5-phosphatase 7 OS=Arabidopsis thaliana GN=IP5P7 PE=1 SV=1 725 938 2.0E-34
sp|Q9SIS4|IP5P9_ARATH Type IV inositol polyphosphate 5-phosphatase 9 OS=Arabidopsis thaliana GN=IP5P9 PE=1 SV=1 640 946 2.0E-33
sp|A8MR21|IP5PA_ARATH Type I inositol polyphosphate 5-phosphatase 10 OS=Arabidopsis thaliana GN=IP5P10 PE=2 SV=1 725 942 1.0E-31
sp|Q66GQ6|IP5P5_ARATH Type I inositol polyphosphate 5-phosphatase 5 OS=Arabidopsis thaliana GN=IP5P5 PE=2 SV=1 726 940 3.0E-31
sp|Q84MA2|IP5P1_ARATH Type I inositol polyphosphate 5-phosphatase 1 OS=Arabidopsis thaliana GN=IP5P1 PE=1 SV=2 726 941 3.0E-31
sp|Q8H0Z6|IP5P3_ARATH Type IV inositol polyphosphate 5-phosphatase 3 OS=Arabidopsis thaliana GN=IP5P3 PE=1 SV=1 726 940 7.0E-31
sp|P42837|FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIG4 PE=1 SV=1 99 611 3.0E-29
sp|Q9JII1|INP5E_MOUSE 72 kDa inositol polyphosphate 5-phosphatase OS=Mus musculus GN=Inpp5e PE=1 SV=1 645 938 5.0E-29
sp|Q9WVR1|INP5E_RAT 72 kDa inositol polyphosphate 5-phosphatase OS=Rattus norvegicus GN=Inpp5e PE=1 SV=2 636 938 7.0E-29
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 725 945 3.0E-28
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 623 946 4.0E-28
sp|Q94A27|SAC2_ARATH Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1 199 610 8.0E-28
sp|A0FI79|INP5E_PANTR 72 kDa inositol polyphosphate 5-phosphatase OS=Pan troglodytes GN=INPP5E PE=2 SV=1 636 938 3.0E-27
sp|Q9NRR6|INP5E_HUMAN 72 kDa inositol polyphosphate 5-phosphatase OS=Homo sapiens GN=INPP5E PE=1 SV=2 636 938 3.0E-27
sp|Q9JMC1|PI5PA_RAT Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Rattus norvegicus GN=Inpp5j PE=1 SV=1 726 943 4.0E-27
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 191 610 5.0E-27
sp|P59644|PI5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus GN=Inpp5j PE=1 SV=2 726 943 6.0E-27
sp|Q15735|PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens GN=INPP5J PE=1 SV=3 726 943 5.0E-26
sp|O80560|IP5PC_ARATH Type I inositol polyphosphate 5-phosphatase 12 OS=Arabidopsis thaliana GN=IP5P12 PE=1 SV=2 623 946 9.0E-26
sp|Q9SKB7|IP5PE_ARATH Type II inositol polyphosphate 5-phosphatase 14 OS=Arabidopsis thaliana GN=IP5P14 PE=1 SV=1 623 951 2.0E-24
sp|Q8RW97|SAC5_ARATH Phosphoinositide phosphatase SAC5 OS=Arabidopsis thaliana GN=SAC5 PE=2 SV=1 191 612 2.0E-24
sp|Q9SYK4|IP5PD_ARATH Type I inositol polyphosphate 5-phosphatase 13 OS=Arabidopsis thaliana GN=IP5P13 PE=1 SV=1 623 958 6.0E-24
sp|Q7XZU1|SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1 99 638 1.0E-23
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 178 635 2.0E-23
sp|Q5EAF2|IP5PB_ARATH Type IV inositol polyphosphate 5-phosphatase 11 OS=Arabidopsis thaliana GN=IP5P11 PE=1 SV=1 633 932 5.0E-23
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 199 610 5.0E-20
sp|P97573|SHIP1_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Rattus norvegicus GN=Inpp5d PE=1 SV=1 631 939 9.0E-19
sp|Q2I6J0|SHP2B_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2B OS=Danio rerio GN=inppl1b PE=2 SV=1 640 938 2.0E-18
sp|Q92835|SHIP1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens GN=INPP5D PE=1 SV=2 631 939 3.0E-18
sp|Q9ES52|SHIP1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Mus musculus GN=Inpp5d PE=1 SV=2 631 939 4.0E-18
sp|Q8C5L6|INP5K_MOUSE Inositol polyphosphate 5-phosphatase K OS=Mus musculus GN=Inpp5k PE=1 SV=2 680 939 5.0E-18
sp|Q9BT40|INP5K_HUMAN Inositol polyphosphate 5-phosphatase K OS=Homo sapiens GN=INPP5K PE=1 SV=3 680 938 8.0E-18
sp|Q2I6J1|SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio GN=inppl1a PE=2 SV=2 643 939 2.0E-17
sp|Q6P549|SHIP2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Mus musculus GN=Inppl1 PE=1 SV=1 643 939 3.0E-17
sp|Q9WVR3|SHIP2_RAT Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Rattus norvegicus GN=Inppl1 PE=1 SV=1 643 939 4.0E-17
sp|O15357|SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens GN=INPPL1 PE=1 SV=2 643 939 6.0E-17
sp|Q91WF7|FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1 261 610 7.0E-17
sp|Q6P4S2|SHIP1_XENLA Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Xenopus laevis GN=inpp5d PE=2 SV=1 680 939 2.0E-16
sp|P34370|I5P2_CAEEL Inositol polyphosphate 5-phosphatase OS=Caenorhabditis elegans GN=cil-1 PE=1 SV=1 688 953 2.0E-16
sp|Q92562|FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1 261 610 5.0E-14
sp|Q08227|INP54_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP54 PE=1 SV=1 680 933 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4107
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5044
Ophiocordyceps australis map64 (Brazil) OphauB2|3030
Ophiocordyceps camponoti-floridani Ophcf2|04364
Ophiocordyceps camponoti-rufipedis Ophun1|3043 (this protein)
Ophiocordyceps kimflemingae Ophio5|3153
Ophiocordyceps subramaniannii Hirsu2|8312

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3043
MDQPPGSWAAPAPAPDKSSELYIRDSPQRSIAIVSSSHALILRYSSSATGAASRNGSHASLPSAKSRSEPAAAKC
MVEFSPISGRLLKDYRPLTPRPIYGTLGLIAANGEVFLSVITRAVRAATVRPGETVERISLVDFYCLSSADYDDV
VPLETLDLDSPDSSSVYGANLPGQGLSRRDVHMEHPCHDLRKLLSNGSFYYSTDFDVTNRLQDRTINSNSFDIDN
FDDTYLWNSFMISPLVQFRSRLLGPEREALDSSRILTSAIRGFCKTMTLPRSSSPLRETKSGMPSFLTLISRLSC
RRAGTRFNARGIDDDGHVANFVETETTFWGPGGPLFSYAQVRGSVPVFWEQAADLIPGRQKITVTRSSEGTQPSF
NKHFEDLEHVYGAVHVINLLSETKPAEAELSAMYHAGIRHCPLSRRGADGSVDRALLRETHYDFHAETKGPAGYE
AARDIRRYIENSTDGFAYFLAVESKDGGESPGGDGPGDGPRMVVVLQQEGVFRTNCLDCLDRTNLIQTLISQMAV
EAFLGHRGDFAASDFWMRHASLWADNGDSLSKIYAGTGALKSSFTRHGKMSLSGAVADMRKSVQRIYHNNFVDPS
RQVTIDMLLGRLFGQAVVHLLDPISDFVSGELARRSDEFTSFETISIWTGTFNLNGRIDGIDYDLSPWLFPPALS
SGQPDIYVVAFQEIVELSPQQIMNSDPSRKSMWEKAVQRSLNSRQAAGDKYVLLRSGQLVGAALCVFVKKSVLAN
IKNVEGSVKKTGLSGMAGNKGAVAIRFDYANTQICFVTAHLAAGFANYDERNRDFETIHRGLRFQRNRGIENHGE
YPAPVPFCLSFEAAKGLIKKNDLATLYDNDQLNLQMQQGLAFPFYSEARISFNPTYKFDIGTDNYDSSEKARIPA
WTDRILRKGQIIRQLTYDSAPLRFSDHRPVYATFECRVSIVDEARRETISKGLYDRRKADMGGAAAHTSDGHDTD
DDDLIGYDAVEGGLPPASSDRDKWWLHNRQPARAQVVVPNGRDGQVMTLNPARASNPFGPSDEAEWVSVPRTSTG
ASLSSISSSHFEKVAKPRPVESPRSSMSVARKPVAKTAAAAEDRDAAGGKRRPETRSRTGQAPLPAPPPPPPPRR
QVGAGVRPETPKGTLGSSKVTGAPVRNSSISSSSSSKATTTTTTKAAPPVAKKPAHLAAPLGAKVAAGGGGTRAA
PTNLMDAADDEIGGGWETLQPSTRA*
Coding >Ophun1|3043
ATGGATCAGCCGCCCGGCTCGTGGGCCGCGCCCGCTCCCGCCCCCGACAAGTCCAGCGAGCTCTACATCCGCGAC
TCTCCCCAGCGCTCCATCGCCATCGTCTCGTCCTCGCACGCCCTGATCCTACGGTACTCGTCCTCTGCTACCGGT
GCCGCCAGCCGCAATGGCTCTCACGCTTCCCTACCGTCGGCCAAGTCGCGATCCGAGCCAGCCGCTGCCAAGTGC
ATGGTCGAGTTCTCGCCCATCTCCGGCCGCCTCCTCAAGGACTATCGGCCCTTGACGCCGCGGCCCATATACGGT
ACCTTGGGTCTGATTGCAGCCAATGGCGAGGTCTTCCTGTCCGTTATTACCCGTGCCGTCAGAGCCGCTACCGTC
CGGCCAGGCGAGACGGTCGAGCGCATCTCCCTCGTCGACTTTTACTGTCTGAGCAGCGCCGACTACGATGACGTG
GTTCCTCTCGAGACTCTCGATCTCGATTCGCCAGACTCTTCCTCTGTTTACGGCGCCAATTTGCCCGGTCAAGGA
CTGAGCAGGCGAGATGTTCATATGGAGCATCCATGCCACGACCTGCGCAAGCTCCTCAGCAACGGCTCCTTTTAC
TACAGTACCGACTTTGACGTGACAAACAGGCTACAGGACCGGACGATCAACTCCAACTCGTTCGATATTGACAAC
TTTGACGACACATACCTCTGGAACTCGTTCATGATCAGCCCCTTGGTTCAATTCCGCTCGCGGCTGTTAGGCCCT
GAACGTGAAGCTCTCGATTCGTCGCGAATCCTGACGTCGGCCATCCGGGGATTCTGCAAGACCATGACGCTGCCA
CGAAGCTCGTCCCCCTTGCGCGAGACCAAGAGCGGCATGCCATCTTTCCTGACGCTGATATCACGTCTCTCGTGT
CGTCGAGCCGGTACTCGCTTCAATGCCAGGGGCATCGACGACGACGGCCACGTTGCCAATTTTGTCGAGACGGAG
ACGACGTTTTGGGGTCCCGGTGGCCCTCTCTTCTCATACGCTCAGGTGCGAGGGTCGGTGCCCGTCTTCTGGGAG
CAGGCTGCCGACCTGATTCCCGGACGGCAAAAGATTACGGTGACGCGGTCATCAGAGGGCACGCAGCCGTCATTC
AACAAGCACTTTGAGGACCTCGAGCACGTCTACGGCGCCGTACATGTCATCAACCTGCTCAGCGAGACGAAGCCG
GCCGAGGCGGAGCTCAGCGCCATGTATCACGCCGGCATCCGGCACTGTCCGCTGAGCCGCCGAGGCGCCGACGGG
TCCGTGGATCGGGCTCTGCTGCGAGAGACGCACTACGATTTCCACGCCGAGACCAAGGGACCGGCCGGGTACGAG
GCGGCGCGTGACATCCGCCGTTATATCGAGAACTCGACCGACGGCTTCGCCTATTTCCTGGCGGTTGAGTCCAAG
GACGGCGGCGAGAGCCCTGGTGGTGATGGCCCCGGTGATGGCCCGCGTATGGTGGTGGTTCTGCAGCAGGAGGGC
GTCTTCCGGACCAACTGTCTCGACTGCCTGGACCGTACGAACCTGATACAGACGCTCATCTCGCAGATGGCCGTC
GAGGCCTTTCTCGGCCATCGTGGTGACTTTGCTGCCTCGGACTTTTGGATGAGGCACGCGAGTCTATGGGCCGAT
AACGGGGACTCGCTGTCCAAGATATACGCCGGCACGGGCGCCCTCAAGTCGTCTTTCACGCGTCACGGAAAGATG
TCGCTCTCGGGCGCCGTGGCCGACATGCGCAAGTCGGTCCAGCGAATCTATCACAACAACTTTGTCGATCCCTCG
CGCCAGGTCACCATTGACATGCTGCTGGGCCGTCTCTTTGGTCAGGCGGTCGTCCATCTACTGGATCCCATCAGC
GACTTTGTGTCGGGCGAGCTCGCGCGTCGAAGCGACGAGTTCACCTCGTTTGAGACCATTAGCATCTGGACGGGC
ACCTTTAACCTAAACGGCCGTATCGACGGCATCGACTACGACCTGTCGCCCTGGTTGTTTCCTCCGGCCTTGAGC
TCAGGGCAGCCGGACATTTACGTCGTCGCCTTCCAGGAGATTGTCGAGCTGAGCCCGCAGCAGATCATGAACAGC
GATCCATCGAGAAAGTCGATGTGGGAGAAGGCGGTTCAACGCAGCCTCAACAGCAGACAGGCTGCCGGCGACAAG
TACGTTCTTCTACGGAGCGGCCAGCTGGTCGGCGCGGCCCTGTGCGTATTTGTCAAGAAGTCAGTCCTGGCCAAT
ATCAAGAACGTCGAGGGCAGCGTCAAGAAGACGGGGCTGTCGGGTATGGCTGGCAACAAGGGCGCCGTTGCTATC
CGATTCGACTACGCCAACACCCAGATCTGCTTCGTCACGGCTCACCTGGCGGCCGGCTTCGCCAACTACGACGAA
CGGAACCGCGACTTTGAGACGATACACAGGGGGTTGCGCTTCCAGCGGAACAGGGGCATCGAGAATCACGGCGAG
TACCCGGCTCCGGTCCCATTTTGCCTGAGCTTCGAGGCGGCCAAGGGGCTGATCAAGAAGAATGATCTGGCCACG
CTGTACGACAACGATCAGCTCAACCTGCAGATGCAGCAGGGCCTCGCGTTTCCCTTTTACTCGGAAGCCCGCATC
AGCTTCAATCCGACGTACAAGTTTGACATTGGCACCGACAACTACGACTCGTCTGAAAAGGCGCGGATTCCAGCC
TGGACGGATCGCATCCTACGAAAGGGCCAAATCATACGACAACTGACGTACGACTCGGCACCGCTGAGATTCTCC
GATCACAGGCCGGTATACGCCACGTTTGAATGCCGGGTCAGCATCGTCGACGAGGCGCGGCGCGAGACCATCAGC
AAGGGGCTTTACGACAGACGCAAGGCTGACATGGGCGGCGCAGCAGCACACACGAGCGACGGACACGACACCGAC
GACGATGATCTGATAGGGTACGACGCCGTCGAAGGGGGCCTGCCGCCGGCGAGCTCGGACCGGGACAAGTGGTGG
CTGCACAACCGGCAGCCGGCGCGGGCTCAGGTCGTCGTTCCCAACGGACGGGACGGACAGGTCATGACACTCAAT
CCGGCCCGGGCGTCGAACCCGTTCGGGCCGAGCGACGAGGCGGAGTGGGTATCGGTGCCGCGGACGTCGACGGGG
GCGTCACTGTCGAGCATCTCCAGCTCGCACTTTGAGAAGGTGGCCAAGCCGCGGCCGGTCGAGAGCCCGAGGTCG
TCCATGTCGGTGGCGAGGAAGCCCGTCGCCAAGACGGCGGCTGCGGCTGAAGATCGGGACGCGGCAGGTGGGAAG
AGACGGCCCGAAACGCGGTCTCGGACGGGACAAGCGCCGCTTCCGGCCCCGCCTCCTCCGCCCCCACCTCGGCGA
CAAGTCGGAGCGGGGGTGCGGCCGGAGACGCCGAAGGGGACATTGGGCAGCAGTAAAGTCACGGGCGCTCCGGTT
CGGAATAGCAGTATCAGCAGCAGCAGCAGCAGCAAGGCGACGACAACGACGACGACCAAGGCGGCGCCTCCGGTG
GCGAAGAAGCCGGCTCACCTGGCGGCGCCGCTGGGAGCCAAGGTAGCGGCGGGCGGCGGCGGCACGCGGGCGGCG
CCGACGAACCTGATGGACGCGGCTGACGATGAGATTGGCGGCGGATGGGAGACGCTGCAGCCAAGCACGCGGGCG
TAG
Transcript >Ophun1|3043
ATGGATCAGCCGCCCGGCTCGTGGGCCGCGCCCGCTCCCGCCCCCGACAAGTCCAGCGAGCTCTACATCCGCGAC
TCTCCCCAGCGCTCCATCGCCATCGTCTCGTCCTCGCACGCCCTGATCCTACGGTACTCGTCCTCTGCTACCGGT
GCCGCCAGCCGCAATGGCTCTCACGCTTCCCTACCGTCGGCCAAGTCGCGATCCGAGCCAGCCGCTGCCAAGTGC
ATGGTCGAGTTCTCGCCCATCTCCGGCCGCCTCCTCAAGGACTATCGGCCCTTGACGCCGCGGCCCATATACGGT
ACCTTGGGTCTGATTGCAGCCAATGGCGAGGTCTTCCTGTCCGTTATTACCCGTGCCGTCAGAGCCGCTACCGTC
CGGCCAGGCGAGACGGTCGAGCGCATCTCCCTCGTCGACTTTTACTGTCTGAGCAGCGCCGACTACGATGACGTG
GTTCCTCTCGAGACTCTCGATCTCGATTCGCCAGACTCTTCCTCTGTTTACGGCGCCAATTTGCCCGGTCAAGGA
CTGAGCAGGCGAGATGTTCATATGGAGCATCCATGCCACGACCTGCGCAAGCTCCTCAGCAACGGCTCCTTTTAC
TACAGTACCGACTTTGACGTGACAAACAGGCTACAGGACCGGACGATCAACTCCAACTCGTTCGATATTGACAAC
TTTGACGACACATACCTCTGGAACTCGTTCATGATCAGCCCCTTGGTTCAATTCCGCTCGCGGCTGTTAGGCCCT
GAACGTGAAGCTCTCGATTCGTCGCGAATCCTGACGTCGGCCATCCGGGGATTCTGCAAGACCATGACGCTGCCA
CGAAGCTCGTCCCCCTTGCGCGAGACCAAGAGCGGCATGCCATCTTTCCTGACGCTGATATCACGTCTCTCGTGT
CGTCGAGCCGGTACTCGCTTCAATGCCAGGGGCATCGACGACGACGGCCACGTTGCCAATTTTGTCGAGACGGAG
ACGACGTTTTGGGGTCCCGGTGGCCCTCTCTTCTCATACGCTCAGGTGCGAGGGTCGGTGCCCGTCTTCTGGGAG
CAGGCTGCCGACCTGATTCCCGGACGGCAAAAGATTACGGTGACGCGGTCATCAGAGGGCACGCAGCCGTCATTC
AACAAGCACTTTGAGGACCTCGAGCACGTCTACGGCGCCGTACATGTCATCAACCTGCTCAGCGAGACGAAGCCG
GCCGAGGCGGAGCTCAGCGCCATGTATCACGCCGGCATCCGGCACTGTCCGCTGAGCCGCCGAGGCGCCGACGGG
TCCGTGGATCGGGCTCTGCTGCGAGAGACGCACTACGATTTCCACGCCGAGACCAAGGGACCGGCCGGGTACGAG
GCGGCGCGTGACATCCGCCGTTATATCGAGAACTCGACCGACGGCTTCGCCTATTTCCTGGCGGTTGAGTCCAAG
GACGGCGGCGAGAGCCCTGGTGGTGATGGCCCCGGTGATGGCCCGCGTATGGTGGTGGTTCTGCAGCAGGAGGGC
GTCTTCCGGACCAACTGTCTCGACTGCCTGGACCGTACGAACCTGATACAGACGCTCATCTCGCAGATGGCCGTC
GAGGCCTTTCTCGGCCATCGTGGTGACTTTGCTGCCTCGGACTTTTGGATGAGGCACGCGAGTCTATGGGCCGAT
AACGGGGACTCGCTGTCCAAGATATACGCCGGCACGGGCGCCCTCAAGTCGTCTTTCACGCGTCACGGAAAGATG
TCGCTCTCGGGCGCCGTGGCCGACATGCGCAAGTCGGTCCAGCGAATCTATCACAACAACTTTGTCGATCCCTCG
CGCCAGGTCACCATTGACATGCTGCTGGGCCGTCTCTTTGGTCAGGCGGTCGTCCATCTACTGGATCCCATCAGC
GACTTTGTGTCGGGCGAGCTCGCGCGTCGAAGCGACGAGTTCACCTCGTTTGAGACCATTAGCATCTGGACGGGC
ACCTTTAACCTAAACGGCCGTATCGACGGCATCGACTACGACCTGTCGCCCTGGTTGTTTCCTCCGGCCTTGAGC
TCAGGGCAGCCGGACATTTACGTCGTCGCCTTCCAGGAGATTGTCGAGCTGAGCCCGCAGCAGATCATGAACAGC
GATCCATCGAGAAAGTCGATGTGGGAGAAGGCGGTTCAACGCAGCCTCAACAGCAGACAGGCTGCCGGCGACAAG
TACGTTCTTCTACGGAGCGGCCAGCTGGTCGGCGCGGCCCTGTGCGTATTTGTCAAGAAGTCAGTCCTGGCCAAT
ATCAAGAACGTCGAGGGCAGCGTCAAGAAGACGGGGCTGTCGGGTATGGCTGGCAACAAGGGCGCCGTTGCTATC
CGATTCGACTACGCCAACACCCAGATCTGCTTCGTCACGGCTCACCTGGCGGCCGGCTTCGCCAACTACGACGAA
CGGAACCGCGACTTTGAGACGATACACAGGGGGTTGCGCTTCCAGCGGAACAGGGGCATCGAGAATCACGGCGAG
TACCCGGCTCCGGTCCCATTTTGCCTGAGCTTCGAGGCGGCCAAGGGGCTGATCAAGAAGAATGATCTGGCCACG
CTGTACGACAACGATCAGCTCAACCTGCAGATGCAGCAGGGCCTCGCGTTTCCCTTTTACTCGGAAGCCCGCATC
AGCTTCAATCCGACGTACAAGTTTGACATTGGCACCGACAACTACGACTCGTCTGAAAAGGCGCGGATTCCAGCC
TGGACGGATCGCATCCTACGAAAGGGCCAAATCATACGACAACTGACGTACGACTCGGCACCGCTGAGATTCTCC
GATCACAGGCCGGTATACGCCACGTTTGAATGCCGGGTCAGCATCGTCGACGAGGCGCGGCGCGAGACCATCAGC
AAGGGGCTTTACGACAGACGCAAGGCTGACATGGGCGGCGCAGCAGCACACACGAGCGACGGACACGACACCGAC
GACGATGATCTGATAGGGTACGACGCCGTCGAAGGGGGCCTGCCGCCGGCGAGCTCGGACCGGGACAAGTGGTGG
CTGCACAACCGGCAGCCGGCGCGGGCTCAGGTCGTCGTTCCCAACGGACGGGACGGACAGGTCATGACACTCAAT
CCGGCCCGGGCGTCGAACCCGTTCGGGCCGAGCGACGAGGCGGAGTGGGTATCGGTGCCGCGGACGTCGACGGGG
GCGTCACTGTCGAGCATCTCCAGCTCGCACTTTGAGAAGGTGGCCAAGCCGCGGCCGGTCGAGAGCCCGAGGTCG
TCCATGTCGGTGGCGAGGAAGCCCGTCGCCAAGACGGCGGCTGCGGCTGAAGATCGGGACGCGGCAGGTGGGAAG
AGACGGCCCGAAACGCGGTCTCGGACGGGACAAGCGCCGCTTCCGGCCCCGCCTCCTCCGCCCCCACCTCGGCGA
CAAGTCGGAGCGGGGGTGCGGCCGGAGACGCCGAAGGGGACATTGGGCAGCAGTAAAGTCACGGGCGCTCCGGTT
CGGAATAGCAGTATCAGCAGCAGCAGCAGCAGCAAGGCGACGACAACGACGACGACCAAGGCGGCGCCTCCGGTG
GCGAAGAAGCCGGCTCACCTGGCGGCGCCGCTGGGAGCCAAGGTAGCGGCGGGCGGCGGCGGCACGCGGGCGGCG
CCGACGAACCTGATGGACGCGGCTGACGATGAGATTGGCGGCGGATGGGAGACGCTGCAGCCAAGCACGCGGGCG
TAG
Gene >Ophun1|3043
ATGGATCAGCCGCCCGGCTCGTGGGCCGCGCCCGCTCCCGCCCCCGACAAGTCCAGCGAGCTCTACATCCGCGAC
TCTCCCCAGCGCTCCATCGCCATCGTCTCGTCCTCGCACGCCCTGATCCTACGGTACTCGTCCTCTGCTACCGGT
GCCGCCAGCCGCAATGGCTCTCACGCTTCCCTACCGTCGGCCAAGTCGCGATCCGAGCCAGCCGCTGCCAAGTGC
ATGGTCGAGTTCTCGCCCATCTCCGGCCGCCTCCTCAAGGACTATCGGCCCTTGACGCCGCGGCCCATATACGGT
ACCTTGGGTCTGATTGCAGCCAATGGCGAGGTCTTCCTGTCCGTTATTACCCGTGCCGTCAGAGCCGCTACCGTC
CGGCCAGGCGAGACGGTCGAGCGCATCTCCCTCGTCGACTTTTACTGTCTGAGCAGCGCCGACTACGATGACGTG
GTTCCTCTCGAGACTCTCGATCTCGATTCGCCAGACTCTTCCTCTGTTTACGGCGCCAATTTGCCCGGTCAAGGA
CTGAGCAGGCGAGATGTTCATATGGAGCATCCATGCCACGACCTGCGCAAGCTCCTCAGCAACGGCTCCTTTTAC
TACAGTACCGACTTTGACGTGACAAACAGGCTACAGGACCGGTAGGGCAGGCTTTCTCCTCCAATTGCTTCTTGA
TACTGAAGCTTACAGGACGATCAACTCCAACTCGTTCGATATTGACAACTTTGACGACACATACCTCTGGAACTC
GTTCATGATCAGCCCCTTGGTTCAATTCCGCTCGCGGCTGTTAGGCCCTGAACGTGAAGCTCTCGATTCGTCGCG
AATCCTGACGTCGGCCATCCGGGGATTCTGCAAGACCATGACGCTGCCACGAAGCTCGTCCCCCTTGCGCGAGAC
CAAGAGCGGCATGCCATCTTTCCTGACGCTGATATCACGTCTCTCGTGTCGTCGAGCCGGTACTCGCTTCAATGC
CAGGGGCATCGACGACGACGGCCACGTTGCCAATTTTGTCGAGACGGAGACGACGTTTTGGGGTCCCGGTGGCCC
TCTCTTCTCATACGCTCAGGTGCGAGGGTCGGTGCCCGTCTTCTGGGAGCAGGCTGCCGACCTGATTCCCGGACG
GCAAAAGATTACGGTGACGCGGTCATCAGAGGGCACGCAGCCGTCATTCAACAAGCACTTTGAGGACCTCGAGCA
CGTCTACGGCGCCGTACATGTCATCAACCTGCTCAGCGAGACGAAGCCGGCCGAGGCGGAGCTCAGCGCCATGTA
TCACGCCGGCATCCGGCACTGTCCGCTGAGCCGCCGAGGCGCCGACGGGTCCGTGGATCGGGCTCTGCTGCGAGA
GACGCACTACGATTTCCACGCCGAGACCAAGGGACCGGCCGGGTACGAGGCGGCGCGTGACATCCGCCGTTATAT
CGAGAACTCGACCGACGGCTTCGCCTATTTCCTGGCGGTTGAGTCCAAGGACGGCGGCGAGAGCCCTGGTGGTGA
TGGCCCCGGTGATGGCCCGCGTATGGTGGTGGTTCTGCAGCAGGAGGGCGTCTTCCGGACCAACTGTCTCGACTG
CCTGGACCGTACGAACCTGATACAGACGCTCATCTCGCAGATGGCCGTCGAGGCCTTTCTCGGCCATCGTGGTGA
CTTTGCTGCCTCGGACTTTTGGATGAGGCACGCGAGTCTATGGGCCGATAACGGGGACTCGCTGTCCAAGATATA
CGCCGGCACGGGCGCCCTCAAGTCGTCTTTCACGCGTCACGGAAAGATGTCGCTCTCGGGCGCCGTGGCCGACAT
GCGCAAGTCGGTCCAGCGAATCTATCACAACAACTTTGTCGATCCCTCGCGCCAGGTCACCATTGACATGCTGCT
GGGCCGTCTCTTTGGTCAGGCGGTCGTCCATCTACTGGATCCCATCAGCGACTTTGTGTCGGGCGAGCTCGCGCG
TCGAAGCGACGAGTTCACCTCGTTTGAGACCATTAGCATCTGGACGGGCACCTTTAACCTAAACGGCCGTATCGA
CGGCATCGACTACGACCTGTCGCCCTGGTTGTTTCCTCCGGCCTTGAGCTCAGGGCAGCCGGACATTTACGTCGT
CGCCTTCCAGGAGATTGTCGAGCTGAGCCCGCAGCAGATCATGAACAGCGATCCATCGAGAAAGTCGATGTGGGA
GAAGGCGGTTCAACGCAGCCTCAACAGCAGACAGGCTGCCGGCGACAAGTACGTTCTTCTACGGAGCGGCCAGCT
GGTCGGCGCGGCCCTGTGCGTATTTGTCAAGAAGTCAGTCCTGGCCAATATCAAGAACGTCGAGGGCAGCGTCAA
GAAGACGGGGCTGTCGGGTATGGCTGGCAACAAGGGCGCCGTTGCTATCCGATTCGACTACGCCAACACCCAGAT
CTGCTTCGTCACGGCTCACCTGGCGGCCGGCTTCGCCAACTACGACGAACGGAACCGCGACTTTGAGACGATACA
CAGGGGGTTGCGCTTCCAGCGGAACAGGGGCATCGAGAATCACGGCGAGTACCCGGCTCCGGTCCCATTTTGTCC
TGAGACGCGCTGACGAGACAGGACTTAGACGCCATCGTGTGGCTGGGCGACTTCAACTACCGTATAGGCCTGAGC
TTCGAGGCGGCCAAGGGGCTGATCAAGAAGAATGATCTGGCCACGCTGTACGACAACGATCAGCTCAACCTGCAG
ATGCAGCAGGGCCTCGCGTTTCCCTTTTACTCGGAAGCCCGCATCAGCTTCAATCCGACGTACAAGTTTGACATT
GGCACCGACAACTACGACTCGTCGTAAGTGGCTCAGATGAGTGAGACCGATGACGGACTTTTACTGACGGAGATG
ATGTTGAAGTGAAAAGGCGCGGATTCCAGCCTGGACGGATCGCATCCTACGAAAGGGCCAAATCATACGACAACT
GACGTACGACTCGGCACCGCTGAGATTCTCCGATCACAGGCCGGTATACGCCACGTTTGAATGCCGGGTCAGCAT
CGTCGACGAGGCGCGGCGCGAGACCATCAGCAAGGGGCTTTACGACAGACGCAAGGCTGACATGGGCGGCGCAGC
AGCACACACGAGCGACGGACACGACACCGACGACGATGATCTGATAGGGTACGACGCCGTCGAAGGGGGCCTGCC
GCCGGCGAGCTCGGACCGGGACAAGTGGTGGCTGCACAACCGGCAGCCGGCGCGGGCTCAGGTCGTCGTTCCCAA
CGGACGGGACGGACAGGTCATGACACTCAATCCGGCCCGGGCGTCGAACCCGTTCGGGCCGAGCGACGAGGCGGA
GTGGGTATCGGTGCCGCGGACGTCGACGGGGGCGTCACTGTCGAGCATCTCCAGCTCGCACTTTGAGAAGGTGGC
CAAGCCGCGGCCGGTCGAGAGCCCGAGGTCGTCCATGTCGGTGGCGAGGAAGCCCGTCGCCAAGACGGCGGCTGC
GGCTGAAGATCGGGACGCGGCAGGTGGGAAGAGACGGCCCGAAACGCGGTCTCGGACGGGACAAGCGCCGCTTCC
GGCCCCGCCTCCTCCGCCCCCACCTCGGCGACAAGTCGGAGCGGGGGTGCGGCCGGAGACGCCGAAGGGGACATT
GGGCAGCAGTAAAGTCACGGGCGCTCCGGTTCGGAATAGCAGTATCAGCAGCAGCAGCAGCAGCAAGGCGACGAC
AACGACGACGACCAAGGCGGCGCCTCCGGTGGCGAAGAAGCCGGCTCACCTGGCGGCGCCGCTGGGAGCCAAGGT
AGCGGCGGGCGGCGGCGGCACGCGGGCGGCGCCGACGAACCTGATGGACGCGGCTGACGATGAGATTGGCGGCGG
ATGGGAGACGCTGCAGCCAAGCACGCGGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail