Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3035
Gene name
LocationContig_27:27181..30314
Strand-
Gene length (bp)3133
Transcript length (bp)3078
Coding sequence length (bp)3078
Protein length (aa) 1026

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00773 RNB RNB domain 1.4E-50 522 884

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47950|CYT4_NEUCR Mitochondrial protein cyt-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-4 PE=3 SV=1 60 1023 7.0E-151
sp|Q1MTN7|RPM1_SCHPO Exoribonuclease II, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpm1 PE=2 SV=2 374 884 2.0E-28
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 483 887 1.0E-20
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 490 1011 3.0E-12
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 756 1002 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47950|CYT4_NEUCR Mitochondrial protein cyt-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-4 PE=3 SV=1 60 1023 7.0E-151
sp|Q1MTN7|RPM1_SCHPO Exoribonuclease II, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpm1 PE=2 SV=2 374 884 2.0E-28
sp|P73177|RN2H_SYNY3 Uncharacterized ribonuclease sll1290 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1290 PE=3 SV=1 483 887 1.0E-20
sp|O32231|RNR_BACSU Ribonuclease R OS=Bacillus subtilis (strain 168) GN=rnr PE=2 SV=1 490 1011 3.0E-12
sp|Q6NQJ6|RNR1_ARATH Ribonuclease II, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=RNR1 PE=2 SV=1 756 1002 2.0E-07
sp|B7VSB8|RNB_VIBTL Exoribonuclease 2 OS=Vibrio tasmaniensis (strain LGP32) GN=rnb PE=3 SV=1 845 1021 2.0E-07
sp|Q7MEL4|RNB_VIBVY Exoribonuclease 2 OS=Vibrio vulnificus (strain YJ016) GN=rnb PE=3 SV=2 845 1021 6.0E-07
sp|Q8D7K6|RNB_VIBVU Exoribonuclease 2 OS=Vibrio vulnificus (strain CMCP6) GN=rnb PE=3 SV=1 845 1021 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004540 ribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0004518 nuclease activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3035
MLSSLYRRPVCSLCLARARVLVTGRIASLPLVSGVRLYSPLPTYEPNESRLWQEPPTRGLPIRETLRKWEKENES
LGSENLPSDLPPEGELSNCLTRTQTTGAQGLVNLSNRDAGLSQITIGHGQPDEVALASSSADSRIPGNLVELRSI
GSRVANLAIYLGYFGGCYHFFSVNGTWMLSMGFPTAFTVTRFAPPHLLDSILDKIPADGTPEVYFDLQSKSLGPK
REDGEILMNMMADFRTDANVVYARHIGEIDNIQEIVPRTSDVEYLSLVEIADRILPATWRLGDRSFPPHVLYAVF
KGLTSQDIACPSVNAAADCRRPDHLFEIYPQTYSLTVDKVSEMVREYVSDVMSKKPVGSGSAATKLPPNIQLLTT
PLLTFIKEAREVVLQSRRHRTPTSCGLIKPSSAVELEKPNFSATSREVLKFLEYWAVYNIFAPECRLHSHGALIL
RALDLYPDRDLNQATAWLFLQEAGILSPWELPSRFKHRLPGITVDKNGGLSRPPPTAIEESMRPDDIAASYRKDR
RNKTVFCIDAASTHLIDDGVSLNRSGLDNVFWIHIHVADPASRLLPNSEFSKYFELLPENVYLPGHFDAMIPSHL
GLNSTDPTSQSLVQQFSLRSRGPALTFSAKVTRAGDVLDGEICPSTIGNVVYLDPEDVANFCQQPPPPPLDEKMK
RRLSVGTRQQSTWPPRKMDKVDGLTKGQKIDLKILYQLAENIRQKRLSKGAWPHYFPKPSVSVGFEASSGEKPSQ
GAKLIPADPYIEVGTDLSIHSTVVSSLMVLAGEVAAKWCSQRGIPIPYRRNTKAANNMEEAYEYATEVLYPLIRK
GIRPTPQQQHTLTLLTGDIELSPRPGPYFLMGLDMYTKATSPLRRFGDLLVHWQIHAAVEFEQIHHRMLEHNKDD
LASILPFTATGLNLPWLKIREKTARRIGNGSLDWTLIALARAWLFEGKKMGRLRFRVRAIWARGLLGQLDLFDVP
ARLDVEGLGGIRLLKDTKIGDEFEVELVDVNVYSRNAIVRALQYLGGGDG*
Coding >Ophun1|3035
ATGCTGTCGAGCCTCTATCGCCGGCCAGTATGCAGCCTATGTCTGGCTCGTGCGCGCGTGCTGGTCACGGGTCGA
ATCGCCTCGCTGCCACTGGTCTCTGGCGTCCGTCTTTACTCGCCTCTGCCCACGTACGAACCGAACGAGAGCCGT
CTCTGGCAAGAGCCTCCAACACGGGGTCTCCCGATCCGAGAGACTCTGCGCAAGTGGGAGAAGGAGAATGAATCT
CTGGGCTCGGAAAACTTGCCCAGCGATCTGCCGCCCGAAGGCGAATTGTCCAACTGCTTGACTCGCACTCAGACG
ACGGGAGCTCAAGGGCTTGTCAACCTCTCCAATCGCGATGCCGGATTGTCGCAGATTACTATCGGACATGGTCAA
CCGGATGAAGTGGCCTTGGCTTCTTCTTCTGCGGACTCTCGCATCCCCGGCAATCTTGTCGAACTCAGGTCTATT
GGCTCCCGCGTCGCCAATCTCGCCATCTATCTCGGATACTTTGGAGGCTGCTATCACTTCTTTTCCGTCAATGGC
ACTTGGATGCTGAGCATGGGCTTTCCCACAGCCTTTACCGTTACTCGATTCGCCCCCCCCCATCTCCTGGACTCG
ATTCTGGACAAGATCCCTGCAGATGGCACTCCGGAAGTTTATTTCGACTTGCAGTCCAAGAGCTTAGGACCCAAG
CGAGAAGACGGCGAGATATTGATGAACATGATGGCAGACTTCAGGACCGACGCCAACGTCGTCTACGCTCGACAC
ATTGGCGAAATCGACAACATTCAGGAAATTGTCCCTCGAACCAGTGATGTCGAGTATCTCAGTCTCGTCGAGATA
GCCGATCGCATTCTGCCCGCCACGTGGAGACTAGGCGACCGCTCGTTTCCTCCCCACGTGCTCTACGCCGTCTTC
AAAGGCTTGACCAGCCAGGACATCGCCTGCCCTTCTGTCAATGCTGCCGCAGACTGTCGCCGTCCCGACCATCTG
TTCGAGATCTATCCGCAGACTTACTCTCTTACCGTCGATAAAGTCTCCGAGATGGTCCGTGAATACGTCAGCGAT
GTCATGTCCAAAAAACCGGTTGGCTCGGGATCCGCTGCGACCAAACTGCCTCCCAACATCCAGCTTTTGACAACA
CCCCTCTTGACTTTTATAAAAGAAGCTCGCGAGGTCGTTCTTCAGAGTCGTCGCCATCGCACTCCCACGTCCTGC
GGCTTGATCAAGCCGTCATCAGCCGTCGAGTTGGAGAAGCCAAACTTTTCTGCCACCAGCAGAGAAGTGCTCAAG
TTCCTCGAGTACTGGGCGGTCTACAACATCTTTGCCCCCGAATGCCGACTTCACTCGCACGGGGCCCTCATCCTC
CGTGCCCTGGATCTGTACCCGGACAGGGATCTCAACCAGGCTACGGCCTGGCTGTTTCTGCAGGAAGCTGGTATC
CTCTCCCCGTGGGAGCTGCCGTCTCGTTTCAAGCATCGCCTGCCGGGTATCACCGTCGATAAGAACGGGGGGCTG
AGCCGCCCACCGCCCACCGCCATCGAGGAGTCGATGAGACCGGATGATATTGCCGCCAGCTACAGGAAAGACAGA
CGGAACAAGACCGTCTTCTGCATCGATGCGGCCTCGACACACCTCATAGACGATGGTGTGTCTCTGAATCGCTCG
GGATTGGACAATGTATTCTGGATTCACATCCACGTTGCCGATCCGGCATCGAGACTGTTGCCAAACTCCGAGTTC
AGCAAATACTTCGAGCTGTTACCGGAGAACGTCTACCTCCCAGGGCATTTTGATGCCATGATACCCAGCCACCTG
GGGCTGAACTCGACCGACCCGACGTCACAGAGTCTTGTTCAGCAGTTTTCCCTGCGCTCCAGGGGACCGGCCTTG
ACGTTCAGCGCGAAAGTGACTCGCGCGGGTGACGTGCTCGACGGCGAAATCTGCCCCTCCACGATCGGAAACGTC
GTCTACCTGGATCCCGAAGACGTGGCCAATTTCTGCCAGCAGCCGCCGCCGCCGCCTCTCGACGAAAAGATGAAG
AGGCGGCTTTCGGTGGGAACCCGGCAGCAATCGACGTGGCCTCCGCGGAAGATGGACAAAGTGGACGGCCTGACA
AAGGGGCAGAAAATCGATCTCAAGATCCTGTACCAGCTGGCCGAGAACATCAGGCAGAAGAGGCTGTCCAAGGGC
GCCTGGCCGCACTACTTTCCCAAGCCGTCGGTGTCGGTCGGCTTCGAGGCCAGCTCGGGAGAGAAGCCGTCTCAG
GGAGCCAAGCTGATTCCGGCGGATCCGTACATCGAGGTGGGCACCGACCTCTCCATACACAGCACCGTCGTCTCC
AGCTTGATGGTGCTGGCCGGAGAGGTGGCGGCCAAGTGGTGCTCGCAGCGCGGCATCCCAATCCCGTATCGCAGG
AACACAAAGGCGGCCAACAACATGGAGGAAGCGTACGAGTACGCGACCGAGGTTCTCTATCCCCTGATCCGGAAG
GGTATCCGGCCGACACCGCAGCAGCAGCACACTCTCACGTTGCTCACGGGAGATATTGAACTTTCGCCGAGGCCC
GGACCGTACTTTCTGATGGGCCTCGACATGTACACCAAGGCCACGTCCCCCTTGCGTCGCTTTGGAGACCTGCTC
GTCCACTGGCAGATCCACGCGGCGGTGGAGTTTGAGCAGATACACCATCGGATGCTGGAACACAACAAGGACGAC
CTGGCCTCCATTCTGCCCTTTACCGCGACCGGGCTGAACCTACCGTGGCTAAAGATACGGGAGAAGACGGCGCGG
CGGATCGGCAACGGATCGCTCGACTGGACGCTGATTGCCCTGGCTCGGGCCTGGCTCTTTGAGGGCAAGAAGATG
GGCCGGCTGAGGTTCCGGGTCAGGGCGATCTGGGCCCGCGGCCTGCTCGGCCAACTCGATCTCTTTGACGTGCCG
GCGCGGCTCGACGTTGAAGGGCTGGGCGGCATCCGTCTTCTCAAGGATACCAAGATTGGGGATGAGTTTGAGGTT
GAGCTGGTGGATGTCAACGTCTACAGCCGGAACGCCATTGTCAGGGCGCTGCAGTACCTCGGAGGCGGCGACGGC
TAG
Transcript >Ophun1|3035
ATGCTGTCGAGCCTCTATCGCCGGCCAGTATGCAGCCTATGTCTGGCTCGTGCGCGCGTGCTGGTCACGGGTCGA
ATCGCCTCGCTGCCACTGGTCTCTGGCGTCCGTCTTTACTCGCCTCTGCCCACGTACGAACCGAACGAGAGCCGT
CTCTGGCAAGAGCCTCCAACACGGGGTCTCCCGATCCGAGAGACTCTGCGCAAGTGGGAGAAGGAGAATGAATCT
CTGGGCTCGGAAAACTTGCCCAGCGATCTGCCGCCCGAAGGCGAATTGTCCAACTGCTTGACTCGCACTCAGACG
ACGGGAGCTCAAGGGCTTGTCAACCTCTCCAATCGCGATGCCGGATTGTCGCAGATTACTATCGGACATGGTCAA
CCGGATGAAGTGGCCTTGGCTTCTTCTTCTGCGGACTCTCGCATCCCCGGCAATCTTGTCGAACTCAGGTCTATT
GGCTCCCGCGTCGCCAATCTCGCCATCTATCTCGGATACTTTGGAGGCTGCTATCACTTCTTTTCCGTCAATGGC
ACTTGGATGCTGAGCATGGGCTTTCCCACAGCCTTTACCGTTACTCGATTCGCCCCCCCCCATCTCCTGGACTCG
ATTCTGGACAAGATCCCTGCAGATGGCACTCCGGAAGTTTATTTCGACTTGCAGTCCAAGAGCTTAGGACCCAAG
CGAGAAGACGGCGAGATATTGATGAACATGATGGCAGACTTCAGGACCGACGCCAACGTCGTCTACGCTCGACAC
ATTGGCGAAATCGACAACATTCAGGAAATTGTCCCTCGAACCAGTGATGTCGAGTATCTCAGTCTCGTCGAGATA
GCCGATCGCATTCTGCCCGCCACGTGGAGACTAGGCGACCGCTCGTTTCCTCCCCACGTGCTCTACGCCGTCTTC
AAAGGCTTGACCAGCCAGGACATCGCCTGCCCTTCTGTCAATGCTGCCGCAGACTGTCGCCGTCCCGACCATCTG
TTCGAGATCTATCCGCAGACTTACTCTCTTACCGTCGATAAAGTCTCCGAGATGGTCCGTGAATACGTCAGCGAT
GTCATGTCCAAAAAACCGGTTGGCTCGGGATCCGCTGCGACCAAACTGCCTCCCAACATCCAGCTTTTGACAACA
CCCCTCTTGACTTTTATAAAAGAAGCTCGCGAGGTCGTTCTTCAGAGTCGTCGCCATCGCACTCCCACGTCCTGC
GGCTTGATCAAGCCGTCATCAGCCGTCGAGTTGGAGAAGCCAAACTTTTCTGCCACCAGCAGAGAAGTGCTCAAG
TTCCTCGAGTACTGGGCGGTCTACAACATCTTTGCCCCCGAATGCCGACTTCACTCGCACGGGGCCCTCATCCTC
CGTGCCCTGGATCTGTACCCGGACAGGGATCTCAACCAGGCTACGGCCTGGCTGTTTCTGCAGGAAGCTGGTATC
CTCTCCCCGTGGGAGCTGCCGTCTCGTTTCAAGCATCGCCTGCCGGGTATCACCGTCGATAAGAACGGGGGGCTG
AGCCGCCCACCGCCCACCGCCATCGAGGAGTCGATGAGACCGGATGATATTGCCGCCAGCTACAGGAAAGACAGA
CGGAACAAGACCGTCTTCTGCATCGATGCGGCCTCGACACACCTCATAGACGATGGTGTGTCTCTGAATCGCTCG
GGATTGGACAATGTATTCTGGATTCACATCCACGTTGCCGATCCGGCATCGAGACTGTTGCCAAACTCCGAGTTC
AGCAAATACTTCGAGCTGTTACCGGAGAACGTCTACCTCCCAGGGCATTTTGATGCCATGATACCCAGCCACCTG
GGGCTGAACTCGACCGACCCGACGTCACAGAGTCTTGTTCAGCAGTTTTCCCTGCGCTCCAGGGGACCGGCCTTG
ACGTTCAGCGCGAAAGTGACTCGCGCGGGTGACGTGCTCGACGGCGAAATCTGCCCCTCCACGATCGGAAACGTC
GTCTACCTGGATCCCGAAGACGTGGCCAATTTCTGCCAGCAGCCGCCGCCGCCGCCTCTCGACGAAAAGATGAAG
AGGCGGCTTTCGGTGGGAACCCGGCAGCAATCGACGTGGCCTCCGCGGAAGATGGACAAAGTGGACGGCCTGACA
AAGGGGCAGAAAATCGATCTCAAGATCCTGTACCAGCTGGCCGAGAACATCAGGCAGAAGAGGCTGTCCAAGGGC
GCCTGGCCGCACTACTTTCCCAAGCCGTCGGTGTCGGTCGGCTTCGAGGCCAGCTCGGGAGAGAAGCCGTCTCAG
GGAGCCAAGCTGATTCCGGCGGATCCGTACATCGAGGTGGGCACCGACCTCTCCATACACAGCACCGTCGTCTCC
AGCTTGATGGTGCTGGCCGGAGAGGTGGCGGCCAAGTGGTGCTCGCAGCGCGGCATCCCAATCCCGTATCGCAGG
AACACAAAGGCGGCCAACAACATGGAGGAAGCGTACGAGTACGCGACCGAGGTTCTCTATCCCCTGATCCGGAAG
GGTATCCGGCCGACACCGCAGCAGCAGCACACTCTCACGTTGCTCACGGGAGATATTGAACTTTCGCCGAGGCCC
GGACCGTACTTTCTGATGGGCCTCGACATGTACACCAAGGCCACGTCCCCCTTGCGTCGCTTTGGAGACCTGCTC
GTCCACTGGCAGATCCACGCGGCGGTGGAGTTTGAGCAGATACACCATCGGATGCTGGAACACAACAAGGACGAC
CTGGCCTCCATTCTGCCCTTTACCGCGACCGGGCTGAACCTACCGTGGCTAAAGATACGGGAGAAGACGGCGCGG
CGGATCGGCAACGGATCGCTCGACTGGACGCTGATTGCCCTGGCTCGGGCCTGGCTCTTTGAGGGCAAGAAGATG
GGCCGGCTGAGGTTCCGGGTCAGGGCGATCTGGGCCCGCGGCCTGCTCGGCCAACTCGATCTCTTTGACGTGCCG
GCGCGGCTCGACGTTGAAGGGCTGGGCGGCATCCGTCTTCTCAAGGATACCAAGATTGGGGATGAGTTTGAGGTT
GAGCTGGTGGATGTCAACGTCTACAGCCGGAACGCCATTGTCAGGGCGCTGCAGTACCTCGGAGGCGGCGACGGC
TAG
Gene >Ophun1|3035
ATGCTGTCGAGCCTCTATCGCCGGCCAGTATGCAGCCTATGTCTGGCTCGTGCGCGCGTGCTGGTCACGGGTCGA
ATCGCCTCGCTGCCACTGGTCTCTGGCGTCCGTCTTTACTCGCCTCTGCCCACGTACGAACCGAACGAGAGCCGT
CTCTGGCAAGAGCCTCCAACACGGGGTCTCCCGATCCGAGAGACTCTGCGCAAGTGGGAGAAGGAGAATGAATCT
CTGGGCTCGGAAAACTTGCCCAGCGATCTGCCGCCCGAAGGCGAATTGTCCAACTGCTTGACTCGCACTCAGACG
ACGGGAGCTCAAGGGCTTGTCAACCTCTCCAATCGCGATGCCGGATTGTCGCAGATTACTATCGGACATGGTCAA
CCGGATGAAGTGGCCTTGGCTTCTTCTTCTGCGGACTCTCGCATCCCCGGCAATCTTGTCGAACTCAGGTGCTCC
CCTCGCTGATCCGGAAGTCTCAGAGCGTCTGAATTGACTCGTCGCCAGGTCTATTGGCTCCCGCGTCGCCAATCT
CGCCATCTATCTCGGATACTTTGGAGGCTGCTATCACTTCTTTTCCGTCAATGGCACTTGGATGCTGAGCATGGG
CTTTCCCACAGCCTTTACCGTTACTCGATTCGCCCCCCCCCATCTCCTGGACTCGATTCTGGACAAGATCCCTGC
AGATGGCACTCCGGAAGTTTATTTCGACTTGCAGTCCAAGAGCTTAGGACCCAAGCGAGAAGACGGCGAGATATT
GATGAACATGATGGCAGACTTCAGGACCGACGCCAACGTCGTCTACGCTCGACACATTGGCGAAATCGACAACAT
TCAGGAAATTGTCCCTCGAACCAGTGATGTCGAGTATCTCAGTCTCGTCGAGATAGCCGATCGCATTCTGCCCGC
CACGTGGAGACTAGGCGACCGCTCGTTTCCTCCCCACGTGCTCTACGCCGTCTTCAAAGGCTTGACCAGCCAGGA
CATCGCCTGCCCTTCTGTCAATGCTGCCGCAGACTGTCGCCGTCCCGACCATCTGTTCGAGATCTATCCGCAGAC
TTACTCTCTTACCGTCGATAAAGTCTCCGAGATGGTCCGTGAATACGTCAGCGATGTCATGTCCAAAAAACCGGT
TGGCTCGGGATCCGCTGCGACCAAACTGCCTCCCAACATCCAGCTTTTGACAACACCCCTCTTGACTTTTATAAA
AGAAGCTCGCGAGGTCGTTCTTCAGAGTCGTCGCCATCGCACTCCCACGTCCTGCGGCTTGATCAAGCCGTCATC
AGCCGTCGAGTTGGAGAAGCCAAACTTTTCTGCCACCAGCAGAGAAGTGCTCAAGTTCCTCGAGTACTGGGCGGT
CTACAACATCTTTGCCCCCGAATGCCGACTTCACTCGCACGGGGCCCTCATCCTCCGTGCCCTGGATCTGTACCC
GGACAGGGATCTCAACCAGGCTACGGCCTGGCTGTTTCTGCAGGAAGCTGGTATCCTCTCCCCGTGGGAGCTGCC
GTCTCGTTTCAAGCATCGCCTGCCGGGTATCACCGTCGATAAGAACGGGGGGCTGAGCCGCCCACCGCCCACCGC
CATCGAGGAGTCGATGAGACCGGATGATATTGCCGCCAGCTACAGGAAAGACAGACGGAACAAGACCGTCTTCTG
CATCGATGCGGCCTCGACACACCTCATAGACGATGGTGTGTCTCTGAATCGCTCGGGATTGGACAATGTATTCTG
GATTCACATCCACGTTGCCGATCCGGCATCGAGACTGTTGCCAAACTCCGAGTTCAGCAAATACTTCGAGCTGTT
ACCGGAGAACGTCTACCTCCCAGGGCATTTTGATGCCATGATACCCAGCCACCTGGGGCTGAACTCGACCGACCC
GACGTCACAGAGTCTTGTTCAGCAGTTTTCCCTGCGCTCCAGGGGACCGGCCTTGACGTTCAGCGCGAAAGTGAC
TCGCGCGGGTGACGTGCTCGACGGCGAAATCTGCCCCTCCACGATCGGAAACGTCGTCTACCTGGATCCCGAAGA
CGTGGCCAATTTCTGCCAGCAGCCGCCGCCGCCGCCTCTCGACGAAAAGATGAAGAGGCGGCTTTCGGTGGGAAC
CCGGCAGCAATCGACGTGGCCTCCGCGGAAGATGGACAAAGTGGACGGCCTGACAAAGGGGCAGAAAATCGATCT
CAAGATCCTGTACCAGCTGGCCGAGAACATCAGGCAGAAGAGGCTGTCCAAGGGCGCCTGGCCGCACTACTTTCC
CAAGCCGTCGGTGTCGGTCGGCTTCGAGGCCAGCTCGGGAGAGAAGCCGTCTCAGGGAGCCAAGCTGATTCCGGC
GGATCCGTACATCGAGGTGGGCACCGACCTCTCCATACACAGCACCGTCGTCTCCAGCTTGATGGTGCTGGCCGG
AGAGGTGGCGGCCAAGTGGTGCTCGCAGCGCGGCATCCCAATCCCGTATCGCAGGAACACAAAGGCGGCCAACAA
CATGGAGGAAGCGTACGAGTACGCGACCGAGGTTCTCTATCCCCTGATCCGGAAGGGTATCCGGCCGACACCGCA
GCAGCAGCACACTCTCACGTTGCTCACGGGAGATATTGAACTTTCGCCGAGGCCCGGACCGTACTTTCTGATGGG
CCTCGACATGTACACCAAGGCCACGTCCCCCTTGCGTCGCTTTGGAGACCTGCTCGTCCACTGGCAGATCCACGC
GGCGGTGGAGTTTGAGCAGATACACCATCGGATGCTGGAACACAACAAGGACGACCTGGCCTCCATTCTGCCCTT
TACCGCGACCGGGCTGAACCTACCGTGGCTAAAGATACGGGAGAAGACGGCGCGGCGGATCGGCAACGGATCGCT
CGACTGGACGCTGATTGCCCTGGCTCGGGCCTGGCTCTTTGAGGGCAAGAAGATGGGCCGGCTGAGGTTCCGGGT
CAGGGCGATCTGGGCCCGCGGCCTGCTCGGCCAACTCGATCTCTTTGACGTGCCGGCGCGGCTCGACGTTGAAGG
GCTGGGCGGCATCCGTCTTCTCAAGGATACCAAGATTGGGGATGAGTTTGAGGTTGAGCTGGTGGATGTCAACGT
CTACAGCCGGAACGCCATTGTCAGGGCGCTGCAGTACCTCGGAGGCGGCGACGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail